1. Recombinant Proteins
  2. CAR-T Related Proteins Receptor Proteins
  3. Folate Receptor alpha (FR-alpha)
  4. FOLR1 Protein, Canine (HEK293, Fc)

FOLR1 is a folic acid receptor that binds to folic acid and reductive folic acid derivatives and promotes the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers. FOLR1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived FOLR1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FOLR1 is a folic acid receptor that binds to folic acid and reductive folic acid derivatives and promotes the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers. FOLR1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived FOLR1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

FOLR1 is a member of the folate receptor (FOLR) family, and the FOLR1 protein is a key mediator of folate uptake, binding to folate and reductive folate derivatives and promoting the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 is also important for normal embryonic development and normal cell proliferation. Autoantibodies to FRA have been linked to neurodevelopmental disorders, particularly brain folate deficiency, schizophrenia, and autism spectrum disorders. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers[1][2][3].

Species

Canine

Source

HEK293

Tag

C-hFc

Accession

XP_851993.1 (R25-M228)

Gene ID
Molecular Construction
N-term
FOLR1 (R25-M228)
Accession # XP_851993.1
hFc
C-term
Protein Length

Partial

Synonyms
Folate receptor alpha; FR-alpha; FBP; FOLR1; FOLR
AA Sequence

RTELLNVCMDAKHHKEKPSPEDGLHKQCSPWKKNSCCFANTSREAHKDISYLYRFNWNHCGSMTPACKKHFIQDTCLYECSPNLGPWIQEVNQSWRKERILHVPLCKEDCEQWWQDCRTSYTCKSNWHKGWNWTSGYNQCPEGAACHPFHFYFPTSAALCSEIWSHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYARAM

Predicted Molecular Mass
50.7 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FOLR1 Protein, Canine (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FOLR1 Protein, Canine (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FOLR1 Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P76936
Quantity:
MCE Japan Authorized Agent: