2. Recombinant Proteins
  3. CAR-T Related Proteins Receptor Proteins
  4. Folate Receptor alpha (FR-alpha)
  5. FOLR1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

FOLR1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

Cat. No.: HY-P77664
Handling Instructions Technical Support

FOLR1 is a folic acid receptor that binds to folic acid and reductive folic acid derivatives and promotes the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers. FOLR1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant cynomolgus, Rhesus Macaque-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

FOLR1 is a folic acid receptor that binds to folic acid and reductive folic acid derivatives and promotes the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers. FOLR1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant cynomolgus, Rhesus Macaque-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
Background

FOLR1 is a member of the folate receptor (FOLR) family, and the FOLR1 protein is a key mediator of folate uptake, binding to folate and reductive folate derivatives and promoting the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 is also important for normal embryonic development and normal cell proliferation. Autoantibodies to FRA have been linked to neurodevelopmental disorders, particularly brain folate deficiency, schizophrenia, and autism spectrum disorders. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers[1][2][3].
Species

Cynomolgus; Rhesus Macaque
Source

HEK293
Tag

C-8*His
Accession

A0A2K5U044/NP_001181576.1 (R25-M233)
Gene ID

102132305/718388  [NCBI]
Molecular Construction
N-term
FOLR1 (R25-M233)
Accession # A0A2K5U044/NP_001181576.1
8*His
C-term
Protein Length

Partial
Synonyms
FOLR; FOLR1; FBP; Folbp1; KB cells FBP; MOv18
AA Sequence

RTARARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWKKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCPVGAACQPFHFYFPTPTVLCNEIWTYSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM

Predicted Molecular Mass
25.6 kDa
분자량

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.
Purity

≥ 95%, as determined by Bis-Tris PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
각종 서류
Handling Instructions (2659 KB)

FOLR1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

FOLR1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
FOLR1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77664
수량:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

Country or Region *

메일주소 *

     

전화번호 *

 

회사명 *

비고

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.