Frataxin/FXN Protein, Human (His, Myc)

Customer Review

Based on 1 Customer Validation

Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

Frataxin/FXN protein serves as an activator within the core iron-sulfur cluster (ISC) assembly complex, facilitating persulfide transfer to the scaffolding protein ISCU and participating in [2Fe-2S] cluster assembly. It expedites sulfur transfer from the NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. Frataxin/FXN is integral to the de novo synthesis of a [2Fe-2S] cluster, initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) producing persulfide, which is delivered to ISCU in a FXN-dependent manner. This complex is stabilized by FDX2, providing reducing equivalents for [2Fe-2S] cluster assembly. The cluster is subsequently transferred from ISCU to chaperone proteins, including HSCB, HSPA9, and GLRX5. Frataxin/FXN may play a role in protecting against iron-catalyzed oxidative stress through its ferroxidase activity, particularly in its oligomeric form. It might also function as an iron chaperone, safeguarding the aconitase [4Fe-4S]2+ cluster and promoting enzyme reactivation. Additionally, Frataxin/FXN may act as a high-affinity iron binding partner for FECH, contributing to mitochondrial heme biosynthesis, modulating the RNA-binding activity of ACO1, and potentially influencing cytoplasmic iron-sulfur protein biogenesis, overall impacting oxidative stress resistance and cell survival.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-Myc;N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • Frataxin (M1-A210)
      Accession # Q16595-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    FXN; CyaY; Prev. FRDA; Friedreich Ataxia Protein; X25; Friedreich Ataxia; Frataxin, Mitochondrial; Fxn; FARR; Frataxin; FA

  • AA Sequence

    MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

  • Predicted Molecular Mass

    28.1 kDa

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00