Frataxin/FXN Protein, Human (His, Myc)

Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of Frataxin/FXN Protein, Human (His, Myc) is 210 a.a., with molecular weight of ~33 kDa.

Frataxin/FXN protein serves as an activator within the core iron-sulfur cluster (ISC) assembly complex, facilitating persulfide transfer to the scaffolding protein ISCU and participating in [2Fe-2S] cluster assembly. It expedites sulfur transfer from the NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. Frataxin/FXN is integral to the de novo synthesis of a [2Fe-2S] cluster, initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) producing persulfide, which is delivered to ISCU in a FXN-dependent manner. This complex is stabilized by FDX2, providing reducing equivalents for [2Fe-2S] cluster assembly. The cluster is subsequently transferred from ISCU to chaperone proteins, including HSCB, HSPA9, and GLRX5. Frataxin/FXN may play a role in protecting against iron-catalyzed oxidative stress through its ferroxidase activity, particularly in its oligomeric form. It might also function as an iron chaperone, safeguarding the aconitase [4Fe-4S]2+ cluster and promoting enzyme reactivation. Additionally, Frataxin/FXN may act as a high-affinity iron binding partner for FECH, contributing to mitochondrial heme biosynthesis, modulating the RNA-binding activity of ACO1, and potentially influencing cytoplasmic iron-sulfur protein biogenesis, overall impacting oxidative stress resistance and cell survival.

Human

E. coli

C-Myc;N-10*His

Q16595 (M1-A210)

2395  [NCBI]

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Approximately 33 kDa

• 
  Greater than 92% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.