FtsZ Protein, E.coli (His-SUMO)
Based on 1 Customer Validation
FtsZ is an essential cell division protein that plays a central role in coordinating the formation of the contractile Z ring at the site of expected cell division. Precise regulation of the components of this ring is a key determinant, affecting the timing and location of cell division. FtsZ Protein, E.coli (His-SUMO) is the recombinant E. coli-derived FtsZ protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FtsZ is an essential cell division protein that plays a central role in coordinating the formation of the contractile Z ring at the site of expected cell division. Precise regulation of the components of this ring is a key determinant, affecting the timing and location of cell division. FtsZ Protein, E.coli (His-SUMO) is the recombinant E. coli-derived FtsZ protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
FtsZ (Filamenting temperature-sensitive mutant Z) protein is an indispensable component of cell division, playing a central role in the formation of the contractile ring structure known as the Z ring at the future site of cell division. The assembly of this ring is crucial for regulating the timing and location of cell division. Functionally, the FtsZ ring serves to recruit various other cell division proteins to the septum, facilitating the synthesis of a new cell wall between dividing cells. As a GTP-binding protein with intrinsic GTPase activity, FtsZ exists as a homodimer and polymerizes to create a dynamic ring structure in a strictly GTP-dependent manner. This dynamic interaction with GTP and its ability to form the Z ring are essential features, highlighting FtsZ's pivotal role in orchestrating the complex process of bacterial cell division. Moreover, FtsZ directly interacts with several other division proteins, emphasizing its central role in coordinating the molecular events necessary for successful cell division (
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
P0A9A7 (M1-D383)
-
Gene ID75202088 [NCBI]
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
FtsZ (M1-D383)
Accession # P0A9A7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Cell division protein FtsZ; ftsZ; c0113
-
AA Sequence
MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD
-
Predicted Molecular Mass
56.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
