1. Recombinant Proteins
  2. Viral Proteins
  3. RSV Proteins
  4. RSV Fusion Proteins
  5. Fusion glycoprotein F0/F Protein, HRSV (AHX57537, sf9, His)

Fusion glycoprotein F0/F Protein, HRSV (AHX57537, sf9, His)

Cat. No.: HY-P75817
Handling Instructions Technical Support

F0/F is a class of viral fusion proteins that, as an inactive precursor, are cleaved by a furfurin-like protease at two sites to produce mature F1 and F2 fusion glycoproteins.The F protein can mediate cell-cell fusion, lead to syncytial formation, and trigger p53-dependent apoptosis in the later stages of infection.Fusion glycoprotein F0/F Protein, HRSV (AHX57537, sf9, His) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

F0/F is a class of viral fusion proteins that, as an inactive precursor, are cleaved by a furfurin-like protease at two sites to produce mature F1 and F2 fusion glycoproteins.The F protein can mediate cell-cell fusion, lead to syncytial formation, and trigger p53-dependent apoptosis in the later stages of infection.Fusion glycoprotein F0/F Protein, HRSV (AHX57537, sf9, His) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

F0/F is a class of viral fusion proteins that, as an inactive precursor, are cleaved by a furfurin-like protease at two sites to produce mature F1 and F2 fusion glycoproteins. The F1-F2 trimer (F protein) plays a dual role, helping to attach to host cells by binding to host heparin sulfate, and facilitating entry into host cells by interacting with host IGFR1. F protein can mediate cell-cell fusion, leading to syncytial formation, and F protein may trigger p53-dependent apoptosis in the late stage of infection[1][2][3].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

AHX57537 (Q26-M526)

Gene ID

/

Molecular Construction
N-term
hMPV F (Q26-M526)
Accession # AHX57537
His
C-term
Protein Length

Partial

Synonyms
Human respiratory syncytial virus (RSV) Fusion protein / RSV-F Protein
AA Sequence

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSSPAANSRARRELPRFMNYTLNNTKNTNVTLSKKRKRRFLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNIDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIM

Predicted Molecular Mass
57 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Fusion glycoprotein F0/F Protein, HRSV (AHX57537, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fusion glycoprotein F0/F Protein, HRSV (AHX57537, sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fusion glycoprotein F0/F Protein, HRSV (AHX57537, sf9, His)
Cat. No.:
HY-P75817
Quantity:
MCE Japan Authorized Agent: