Fusion glycoprotein F0/F Protein, HRSVA (His, B2M)

The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states. Fusion glycoprotein F0/F Protein, HRSVA (His, B2M) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by E. coli , with N-B2M, N-6*His labeled tag. The total length of Fusion glycoprotein F0/F Protein, HRSVA (His, B2M) is 503 a.a., with molecular weight of ~69.9 kDa.

The Fusion glycoprotein F0/F Protein acts as an inactive precursor, undergoing cleavage at two sites by a furin-like protease to generate the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it exhibits at least three conformational states: the pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and plasma cell membrane fusion, the coiled coil regions adopt a trimer-of-hairpins structure, placing the fusion peptide in proximity to the C-terminal region of the ectodomain. This structural arrangement drives the apposition and subsequent fusion of viral and cellular membranes, facilitating the delivery of the nucleocapsid into the cytoplasm. Importantly, this fusion is pH independent and occurs at the plasma or endosomal membrane. The trimer of F1-F2 (F protein) plays a dual role by aiding attachment to host cells through binding to host heparan sulfate and facilitating entry into the host cell via interaction with host IGFR1. Furthermore, F protein expressed at the plasma membrane during infection can mediate cell-cell fusion, leading to syncytia formation, a cytopathic effect potentially contributing to tissue necrosis. Additionally, F protein may trigger p53-dependent apoptosis later in infection.

Virus

E. coli

N-B2M;N-6*His

P03420 (N27-T529)

/

NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

Approximately 69.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.