1. Recombinant Proteins
  2. Viral Proteins
  3. RSV Proteins
  4. RSV Fusion Proteins
  5. Fusion glycoprotein F0/F Protein, HRSV (His, B2M)

Fusion glycoprotein F0/F Protein, HRSV (His, B2M)

Art. -Nr.: HY-P71478
Handling Instructions Technical Support

The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states. Fusion glycoprotein F0/F Protein, HRSV (His, B2M) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by E. coli , with N-B2M, N-6*His labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
Kostenlose Probe   Apply now
5 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states. Fusion glycoprotein F0/F Protein, HRSV (His, B2M) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by E. coli , with N-B2M, N-6*His labeled tag.

Background

The Fusion glycoprotein F0/F Protein acts as an inactive precursor, undergoing cleavage at two sites by a furin-like protease to generate the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it exhibits at least three conformational states: the pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and plasma cell membrane fusion, the coiled coil regions adopt a trimer-of-hairpins structure, placing the fusion peptide in proximity to the C-terminal region of the ectodomain. This structural arrangement drives the apposition and subsequent fusion of viral and cellular membranes, facilitating the delivery of the nucleocapsid into the cytoplasm. Importantly, this fusion is pH independent and occurs at the plasma or endosomal membrane. The trimer of F1-F2 (F protein) plays a dual role by aiding attachment to host cells through binding to host heparan sulfate and facilitating entry into the host cell via interaction with host IGFR1. Furthermore, F protein expressed at the plasma membrane during infection can mediate cell-cell fusion, leading to syncytia formation, a cytopathic effect potentially contributing to tissue necrosis. Additionally, F protein may trigger p53-dependent apoptosis later in infection.

Species

Virus

Source

E. coli

Tag

N-B2M;N-6*His

Accession

P03420 (N27-T529)

Gene ID

/

Protein Length

Partial

Synonyms
Fusion glycoprotein F0; Protein F; Interchain peptide; Fusion glycoprotein F2; Human respiratory syncytial virus A Fusion glycoprotein F0
AA Sequence

NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

Molekulargewicht

Approximately 69.9 kDa

Reinheit

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation

Fusion glycoprotein F0/F Protein, HRSV (His, B2M) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Fusion glycoprotein F0/F Protein, HRSV (His, B2M)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Fusion glycoprotein F0/F Protein, HRSV (His, B2M)
Art. -Nr.:
HY-P71478
Menge:
MCE Japan Authorized Agent: