G-CSF Protein, Human (HEK293)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free. The total length of G-CSF Protein, Human (HEK293) is 175 a.a., with molecular weight of ~17.8 kDa.

Granulocyte/macrophage colony-stimulating factor (G-CSF) is a cytokine crucial for hematopoiesis, exerting control over the production, differentiation, and function of two key white cell populations: granulocytes and monocytes-macrophages. As a monomeric protein, G-CSF specifically induces the development of granulocytes, contributing to the regulation of the immune system and blood cell formation.

Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells and the ED₅₀ is typically 0.04-0.2 ng/mL.

Human

HEK293

Tag Free

P09919-2/NP_757373.1 (A30-P204)

1440  [NCBI]

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Approximately 17.8 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.