1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Human (HEK293, Fc)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293, Fc) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE G-CSF Protein, Human (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293, Fc) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Granulocyte/macrophage colony-stimulating factor (G-CSF) is a cytokine crucial for hematopoiesis, exerting control over the production, differentiation, and function of two key white cell populations: granulocytes and monocytes-macrophages. As a monomeric protein, G-CSF specifically induces the development of granulocytes, contributing to the regulation of the immune system and blood cell formation.

Biological Activity

Immobilized Human G-CSF R, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human G-CSF, hFc Tag with the EC50 of 4.4 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P09919-2/NP_757373.1 (T31-P204)

Gene ID
Molecular Construction
N-term
hFc
G-CSF (T31-P204)
Accession # P09919-2/NP_757373.1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Granulocyte Colony-Stimulating Factor; G-CSF; CSF3; C17orf33
AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Predicted Molecular Mass
44.2 kDa
Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

G-CSF Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

G-CSF Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
G-CSF Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73073
Quantity:
MCE Japan Authorized Agent: