Galectin-3/LGALS3 Protein, Cynomolgus (HEK293, His)

The Galectin-3/LGALS3 protein is a galactose-specific lectin known for its diverse roles in cellular processes. It binds IgE and synergizes with α-3 and β-1 integrins to promote CSPG4-induced endothelial cell migration. Galectin-3/LGALS3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with N-His labeled tag.

The Galectin-3/LGALS3 Protein is a galactose-specific lectin known for its versatile roles in cellular processes. It binds IgE and, in collaboration with the alpha-3, beta-1 integrin, facilitates CSPG4-induced migration of endothelial cells. Together with DMBT1, it is crucial for the terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus, the protein serves as a pre-mRNA splicing factor and is actively involved in acute inflammatory responses, influencing neutrophil activation, adhesion, chemoattraction of monocytes and macrophages, opsonization of apoptotic neutrophils, and mast cell activation. Its partnership with TRIM16 allows for the coordinated recognition of membrane damage, triggering the mobilization of core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. The protein likely forms homo- or heterodimers and engages with various partners, including DMBT1, CD6, ALCAM, ITGA3, ITGB1, CSPG4, LGALS3BP, LYPD3, ZFTRAF1, UACA, TRIM16, and TMED10, facilitating diverse cellular interactions, including autophagy and secretion.

Immobilized Cynomolgus Galectin 3, His Tag at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Anti-Galectin 3 Antibody, hFc Tag with the EC₅₀ of <38.4 ng/mL determined by ELISA.

Cynomolgus

HEK293

N-8*His

A0A2K5U233/XP_005561371.1 (A2-I248)

102145569  [NCBI]

Full Length of Mature Protein

ADNFSLHDALSGSGNPNPQGWPGPWGNQPAGAGGYPGASYPGAYPGQAPPGVYPGQAPPGAYPGAPGAYSGASGVYPGPPSGAGAYPSPGQPSAPGAYPATGPYGAPAGPLSVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFKRRNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRVKQLNEISQLGISGDIDLTNASYTMI

35-48 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Hepes, 150 mM NaCl, 200 mM L-Arginine, 2 mM Tcep, pH 6.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.