Copy Link Print Information

GALNT3 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

GALNT3 Protein initiates O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine on protein receptors, including HIV envelope glycoproteins (gp120), EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin. GALNT3 also glycosylates FGF23 in vivo. GALNT3 Protein, Human (HEK293, His) is the recombinant human-derived GALNT3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for GALNT3 Protein, Human (HEK293, His)
  • GALNT3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GALNT3 Protein initiates O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine on protein receptors, including HIV envelope glycoproteins (gp120), EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin. GALNT3 also glycosylates FGF23 in vivo. GALNT3 Protein, Human (HEK293, His) is the recombinant human-derived GALNT3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

GALNT3 protein serves as a crucial catalyst in the initiation of O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. This enzymatic activity, demonstrated on various substrates including HIV envelope glycoprotein gp120, EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin and FGF23, plays a central role in the glycosylation processes essential for the proper functioning of numerous proteins involved in diverse cellular functions.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q14435-1 (Q38-D633)

  • Gene ID
    2591  [NCBI]
  • Molecular Construction
    • N-term
    • GALNT3 (Q38-D633)
      Accession # Q14435-1
    • 6*His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    GALNT3; UDP-GalNAc:Polypeptide N-Acetylgalactosaminyltransferase 3; Polypeptide N-Acetylgalactosaminyltransferase 3; Protein-UDP Acetylgalactosaminyltransferase 3; GalNAc-T3; Pp-GaNTase 3; Polypeptide GalNAc Transferase 3; Polypeptide N-Acetylgalactosamin

  • AA Sequence

    QREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILSQND

  • Predicted Molecular Mass

    69.1 kDa

  • Molecular Weight

    Approximately 80 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • GALNT3 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for GALNT3 Protein, Human (HEK293, His)
  • GALNT3 Protein, Human (HEK293, His) Product Image