1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GALNT3 Protein, Human (HEK293, His)

GALNT3 Protein, Human (HEK293, His)

Cat. No.: HY-P70831
COA Handling Instructions

GALNT3 Protein initiates O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine on protein receptors, including HIV envelope glycoproteins (gp120), EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin. GALNT3 also glycosylates FGF23 in vivo. GALNT3 Protein, Human (HEK293, His) is the recombinant human-derived GALNT3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GALNT3 Protein, Human (HEK293, His) is 596 a.a., with molecular weight of ~80.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $155 In-stock
50 μg $430 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GALNT3 Protein initiates O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine on protein receptors, including HIV envelope glycoproteins (gp120), EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin. GALNT3 also glycosylates FGF23 in vivo. GALNT3 Protein, Human (HEK293, His) is the recombinant human-derived GALNT3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GALNT3 Protein, Human (HEK293, His) is 596 a.a., with molecular weight of ~80.0 kDa.

Background

GALNT3 protein serves as a crucial catalyst in the initiation of O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. This enzymatic activity, demonstrated on various substrates including HIV envelope glycoprotein gp120, EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin and FGF23, plays a central role in the glycosylation processes essential for the proper functioning of numerous proteins involved in diverse cellular functions.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14435 (Q38-D633)

Gene ID
Molecular Construction
N-term
GALNT3 (Q38-D633)
Accession # Q14435
6*His
C-term
Synonyms
Polypeptide N-acetylgalactosaminyltransferase 3; Polypeptide GalNAc transferase 3; GalNAc-T3; pp-GaNTase 3; Protein-UDP acetylgalactosaminyltransferase 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; HFTC; HHS
AA Sequence

QREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILSQND

Molecular Weight

Approximately 80.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

GALNT3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GALNT3 Protein, Human (HEK293, His)
Cat. No.:
HY-P70831
Quantity:
MCE Japan Authorized Agent: