GAMT Protein, Human (His)

GAMT protein uses S-adenosylmethionine as a methyl donor to catalyze the conversion of guanidinoacetic acid into creatine, playing a key role in cell metabolism. This enzyme activity is essential for the biosynthesis of creatine, a compound necessary for cellular energy storage and transport. GAMT Protein, Human (His) is the recombinant human-derived GAMT protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of GAMT Protein, Human (His) is 236 a.a., with molecular weight of 27-32 kDa.

The GAMT protein is a vital enzyme that converts guanidinoacetate to creatine, utilizing S-adenosylmethionine as the methyl donor. This biochemical process is essential for creatine biosynthesis, a crucial compound involved in energy metabolism, particularly in tissues with high energy demands such as muscle and brain. The enzymatic activity of GAMT is particularly significant in the nervous system development, underscoring its importance in ensuring the availability of creatine for proper cellular function. The conversion of guanidinoacetate to creatine by GAMT is a critical step in maintaining the balance of creatine levels, contributing to energy homeostasis and supporting normal neurological development.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His;C-6*His

Q14353 (M1-G236)

2593  [NCBI]

MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG

27-32 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, pH 8.0 .

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.