GDF-11/BMP-11 Protein, Human (HEK293, solution)

Customer Review

Based on 1 Customer Validation

The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free.

Background

GDF-11/BMP-11 is a secreted signaling protein with a global regulatory impact on anterior/posterior axial patterning during development and is implicated in critical roles in mesodermal and neural tissue patterning. Essential for proper vertebral and orofacial development, GDF-11/BMP-11 transmits signals through activin receptors type-2 (ACVR2A and ACVR2B) and activin receptors type-1 (ACVR1B, ACVR1C, and TGFBR1), leading to the phosphorylation of SMAD2 and SMAD3. The protein forms homodimers through disulfide linkages and interacts directly with ACVR2A, ACVR2B, ACVR1B, TGFBR1, and ACVR1C, the latter in an ACVR2B-dependent manner. Additionally, GDF-11/BMP-11 engages with FST isoform 2/FS-288, highlighting its intricate interactions with key receptors in the signaling pathway.

In Vitro

GDF-11/BMP-11 (5, 10, 20, and 40 ng/mL; 7 d) maintains the colony and cellular morphology of undifferentiated human embryonic stem cells (hESC), maintains POU5f1, NANOG, TRA-1-60, and SSEA4 expression, and displays increased SMAD2/3 phosphorylation in serum-free medium at 20 ng/mL concentration[4].
GDF-11/BMP-11 (50-400 ng/mL; 2 d) induces browning of 3T3-L1 adipocytes via coordination of multiple signalling pathways, including mTORC1-COX2 and p38MAPK-PGC-1α as non-canonical pathways, as well as Smad1/5/8 as a canonical pathway[5].

Verified Bioactivity

Luspatercept immobilized on CM5 Sensor Chip can bind Human GDF-11 Protein with an affinity constant of 18 nM as determined in SPR assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BMP-11 (N299-S407)
      Accession # O95390
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GDF11; Growth/Differentiation Factor 11; Growth Differentiation Factor 11; Bone Morphogenetic Protein 11; BMP-11; GDF-11; BMP11; VHO

  • AA Sequence

    NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

  • Predicted Molecular Mass

    12.5 kDa

  • Molecular Weight

    Approximately 13-20 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 50% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00