GDF-11/BMP-11 Protein, Human (HEK293, solution)

The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free. The total length of GDF-11/BMP-11 Protein, Human (HEK293, solution) is 109 a.a., with molecular weight of ~14.0 kDa.

GDF-11/BMP-11 is a secreted signaling protein with a global regulatory impact on anterior/posterior axial patterning during development and is implicated in critical roles in mesodermal and neural tissue patterning. Essential for proper vertebral and orofacial development, GDF-11/BMP-11 transmits signals through activin receptors type-2 (ACVR2A and ACVR2B) and activin receptors type-1 (ACVR1B, ACVR1C, and TGFBR1), leading to the phosphorylation of SMAD2 and SMAD3. The protein forms homodimers through disulfide linkages and interacts directly with ACVR2A, ACVR2B, ACVR1B, TGFBR1, and ACVR1C, the latter in an ACVR2B-dependent manner. Additionally, GDF-11/BMP-11 engages with FST isoform 2/FS-288, highlighting its intricate interactions with key receptors in the signaling pathway.

Human

HEK293

Tag Free

O95390 (N299-S407)

10220  [NCBI]

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 50% glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.