1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GFER Protein, Rat (His-SUMO)

GFER Protein, Rat (His-SUMO)

Cat. No.: HY-P71571
Handling Instructions

The GFER protein is a FAD-dependent sulfhydryl oxidase that restores redox-active disulfide bonds in CHCHD4/MIA40, an important partner for protein folding in the mitochondrial intermembrane space. GFER Protein, Rat (His-SUMO) is the recombinant rat-derived GFER protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of GFER Protein, Rat (His-SUMO) is 198 a.a., with molecular weight of ~38.8 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GFER protein is a FAD-dependent sulfhydryl oxidase that restores redox-active disulfide bonds in CHCHD4/MIA40, an important partner for protein folding in the mitochondrial intermembrane space. GFER Protein, Rat (His-SUMO) is the recombinant rat-derived GFER protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of GFER Protein, Rat (His-SUMO) is 198 a.a., with molecular weight of ~38.8 kDa.

Background

GFER, a flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase, serves as a crucial enzyme in the mitochondrial intermembrane space by facilitating the regeneration of redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding. The intricacy of this process involves the reduced form of CHCHD4/MIA40 transiently forming an intermolecular disulfide bridge with GFER/ERV1. This interaction results in the replenishment of essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 undergoes re-oxidization by donating electrons to cytochrome c or molecular oxygen. Beyond its role in redox regulation, GFER may play a functional role in liver regeneration and spermatogenesis, further highlighting its significance in cellular processes beyond mitochondrial protein folding.

Species

Rat

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q63042 (1M-198D)

Gene ID

27100  [NCBI]

Molecular Construction
N-term
6*His-SUMO
GFER (1M-198D)
Accession # Q63042
C-term
Synonyms
Gfer; AlrFAD-linked sulfhydryl oxidase ALR; EC 1.8.3.2; Augmenter of liver regeneration
AA Sequence

MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Molecular Weight

Approximately 38.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GFER Protein, Rat (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFER Protein, Rat (His-SUMO)
Cat. No.:
HY-P71571
Quantity:
MCE Japan Authorized Agent: