GFER Protein, Rat (His-SUMO)
The GFER protein is a FAD-dependent sulfhydryl oxidase that restores redox-active disulfide bonds in CHCHD4/MIA40, an important partner for protein folding in the mitochondrial intermembrane space.GFER Protein, Rat (His-SUMO) is the recombinant rat-derived GFER protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GFER protein is a FAD-dependent sulfhydryl oxidase that restores redox-active disulfide bonds in CHCHD4/MIA40, an important partner for protein folding in the mitochondrial intermembrane space.GFER Protein, Rat (His-SUMO) is the recombinant rat-derived GFER protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
Background
GFER, a flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase, serves as a crucial enzyme in the mitochondrial intermembrane space by facilitating the regeneration of redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding. The intricacy of this process involves the reduced form of CHCHD4/MIA40 transiently forming an intermolecular disulfide bridge with GFER/ERV1. This interaction results in the replenishment of essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 undergoes re-oxidization by donating electrons to cytochrome c or molecular oxygen. Beyond its role in redox regulation, GFER may play a functional role in liver regeneration and spermatogenesis, further highlighting its significance in cellular processes beyond mitochondrial protein folding.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q63042 (M1-D198)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
GFER (M1-D198)
Accession # Q63042 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GFER; Growth Factor, Erv1 (S. Cerevisiae)-Like (Augmenter Of Liver Regeneration); Growth Factor, Augmenter Of Liver Regeneration; Augmenter Of Liver Regeneration; HERV1; ERV1 Homolog (S. Cerevisiae); ALR; Erv1-Like Growth Factor; FAD-Linked Sulfhydryl Oxi
-
AA Sequence
MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD
-
Predicted Molecular Mass
38.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
