GFP Protein, Aequorea victoria (His)

The GFP protein acts as an energy transfer receptor and is actively involved in the transduction of blue chemiluminescence produced by the protein aequorin. Its main function is to convert this chemical energy into green fluorescence through an efficient energy transfer process. GFP Protein, Aequorea victoria (His) is the recombinant GFP protein, expressed by E. coli , with N-6*His labeled tag. The total length of GFP Protein, Aequorea victoria (His) is 238 a.a., with molecular weight of 27-31 kDa.

The Green Fluorescent Protein (GFP) serves as an energy-transfer acceptor, converting the blue chemiluminescence emitted by the protein aequorin into green fluorescent light through energy transfer. GFP's unique ability to fluoresce in vivo is contingent upon receiving energy from the Ca(2+)-activated photoprotein aequorin. This remarkable property has made GFP an invaluable tool in molecular and cellular biology, enabling the visualization of specific proteins and cellular structures in living organisms. The utilization of GFP as a fluorescent marker has revolutionized biological research, facilitating non-invasive and real-time imaging of dynamic cellular processes (

Others

E. coli

N-6*His

P42212 (M1-K238)

/

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

27-31 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 1 year, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.