Growth Hormone R/GHR Protein, Mouse (HEK293, Fc)

Growth Hormone R/GHR Protein, especially in its soluble form GHBP, acts as a plasma reservoir for growth hormone. GHBP not only regulates growth hormone availability but also potentially modulates or inhibits growth hormone signaling. This dual role highlights GHBP's regulatory impact on the intricate signaling pathways associated with growth hormone activity in the circulatory system. Growth Hormone R/GHR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Growth Hormone R/GHR Protein, Mouse (HEK293, Fc) is 273 a.a., with molecular weight of 65-90 kDa.

The Growth Hormone R/GHR Protein, particularly in its soluble form known as GHBP, serves as a reservoir for growth hormone in plasma. This soluble variant has the additional role of potentially modulating or inhibiting growth hormone signaling. By acting as a reservoir, GHBP contributes to the regulation and availability of growth hormone in the circulatory system, and its modulatory or inhibitory function suggests a regulatory role in the complex signaling pathways associated with growth hormone activity.

Mouse

HEK293

C-hFc

Q3UP14 (M1-Q273)

14600  [NCBI]

MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQ

65-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.