Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein, Human (HEK293, His)

Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein is a lysosomal enzyme present in all cells. It is involved in the catabolism of heparin, heparin sulfate and keratin sulfate. Deficiency of this enzyme leads to inadequate substrate accumulation and lysosomal storage impairment IIID mucopolysaccharidosis. Glucosamine (N-acetyl) -6-Sulfatase/GNS Protein, Human (HEK293, His) is the recombinant human-derived Glucosamine, expressed by HEK293 , with C-6*His labeled tag. The total length of Glucosamine (N-acetyl) -6-Sulfatase/GNS Protein, Human (HEK293, His) is 516 a.a., with molecular weight of ~90 kDa.

Sulfatase catalyzes the hydrolysis of O- and N-sulfate esters from various substrates. Most sulfatases are found in lysosomes. Used to remove sulfate from glycosaminoglycans (GAGs), glycopeptides and glycolipids (GLs). N-acetylglucosamine-6-sulfatase is a lysosomal enzyme present in all cells. It is involved in the catabolism of heparin, heparin sulfate and keratin sulfate. Deficiency of this enzyme leads to inadequate substrate accumulation and lysosomal storage impairment IIID mucopolysaccharidosis^[1][2][3][4].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

P15586 (V37-L552)

2799  [NCBI]

VFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL

Approximately 90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.