GM-CSF Protein, Feline (M36I, T56A, K126N)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Feline (M36I, T56A, K126N) is the recombinant GM-CSF protein, expressed by E. coli , with tag free.

Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) is a cytokine known for its role in stimulating the growth and differentiation of hematopoietic precursor cells across various lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer. Its signaling mechanism involves interaction with the GM-CSF receptor complex, which forms a dodecamer consisting of two head-to-head hexamers involving two alpha, two beta, and two ligand subunits. Through this intricate receptor complex, GM-CSF orchestrates the regulation of hematopoiesis, contributing to the development and maturation of diverse blood cell types.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 10-26 ng/mL.

Others

E. coli

Tag Free

O62757/AAC06041 (A18-K144, M36I, T56A, K126N)

493805  [NCBI]

Full Length of Mature Protein

APTSSPSSVTRPWQHVDAIKEALSLLNNSSEITAVMNEAVEVVSEMFDPEEPKCLQTHLKLYEQGLRGSLISLKEPLRMMANHYKQHCPLTPETPCETQTITFKNFKENLKDFLFNNPFDCWGPDQK

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS with BSA as a carrier protein or 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.