GM-CSF Protein, Mouse

GM-CSF Protein, Mouse is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells.

Granulocyte Macrophage Colony Stimulating Factor is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells including mature neutrophils, macrophages, and dendritic cells^[1].

1.The ED₅₀ is <50 pg/mL as measured by murine FDC-P1 cells, corresponding to a specific activity of >2 × 10⁷ units/mg.
2.Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED₅₀ for this effect is 7.539 pg/mL, corresponding to a specific activity is 1.326×10⁸ units/mg.

• 
  Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED₅₀ for this effect is 7.539 pg/mL, corresponding to a specific activity is1.326×10⁸ units/mg.

Mouse

E. coli

Tag Free

Q14AD9 (A18-K141)

12981  [NCBI]

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Approximately 15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 20 mM Tris-HCl, 1 mM EDTA, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Malekian R, et al. High-yield Production of Granulocyte-macrophage Colony-stimulating Factor in E. coli BL21 (DE3) By an Auto-induction Strategy. Iran J Pharm Res. 2019 Winter;18(1):469-478.  [Content Brief]