1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF
  5. GM-CSF Protein, Mouse

GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse is a recombinant GM-CSF Protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

38 Publications Citing Use of MCE GM-CSF Protein, Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse is a recombinant GM-CSF Protein expressed by E. coli without a tag[1][2][3][4].

Background

GM-CSF is a cytokine secreted by various cells (such as T cells, monocytes, endothelial cells, etc.), playing an important role in the immune system and hematopoietic process. GM-CSF can stimulate the proliferation and differentiation of precursor cells of granulocytes (such as neutrophils and eosinophils) and macrophages in the bone marrow, promoting the production of mature blood cells. GM-CSF can also activate mature granulocytes and macrophages, enhancing their phagocytic ability, bactericidal activity, and antigen-presenting function, and participating in innate and adaptive immune responses. In addition, GM-CSF also has pro-inflammatory activity[1][2][3][4].

In Vitro

GM-CSF Protein (Mouse; 25 ng/mL; 30 min-24 h) enhances glycolytic capacity in mouse bone marrow-derived macrophages, upregulates the expression of glucose transporters GLUT-1, -3, and -4, and induces the transcription and protein expression of c-Myc[5].

In Vivo

GM-CSF Protein (Mouse; 2-4 ng; aerosol inhalation; 4-5 weeks) improves pulmonary alveolar proteinosis in GM-CSF-deficient mice[6].

Biological Activity

1.The ED50 is <5 pg/mL as measured by murine FDC-P1 cells, corresponding to a specific activity of >2 × 107 units/mg.
2.Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED50 for this effect is ≤30 pg/mL, corresponding to a specific activity is ≥3.33×107 units/mg.
3.Mouse GM-CSF R alpha captured on CM5 Chip can bind Mouse GM-CSF with an affinity constant of 2.279 nM as determined in SPR assay.

  • Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED50 for this effect is 7.539 pg/mL, corresponding to a specific activity is 1.326×108 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q14AD9 (A18-K141)

Gene ID
Molecular Construction
N-term
GM-CSF (A18-K141)
Accession # Q14AD9
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuGM-CSF; CSF-2; GM-CSF
AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Predicted Molecular Mass
14.2 kDa
Molecular Weight

Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GM-CSF Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GM-CSF Protein, Mouse

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Mouse
Cat. No.:
HY-P7361
Quantity:
MCE Japan Authorized Agent: