GM-CSF Protein, Rhesus macaque

GM-CSF Protein, Rhesus macaque functions as a cytokine and affects many cell types, especially macrophages and eosinophils.

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is a monomeric glycoprotein that functions as a cytokine —it is a white blood cell growth factor^[1]. GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes. Monocytes exit the circulation and migrate into tissue, whereupon they mature into macrophages and dendritic cells. GM-CSF also has some effects on mature cells of the immune system. These include, for example, inhibiting neutrophil migration and causing an alteration of the receptors expressed on the cells surface^[2]. GM-CSF also plays a role in embryonic development by functioning as an embryokine produced by reproductive tract^[3].

The ED₅₀ is <0.1 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0 × 10⁷ units/mg.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells.. The ED₅₀ for this effect is 23.60 pg/mL, corresponding to a specific activity is 4.24×10⁷ units/mg.

Rhesus Macaque

E. coli

Tag Free

Q9GL44 (A18-E144)

574371  [NCBI]

Full Length of Mature Protein

APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQEPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFQSFKENLKDFLLVIPFDCWEPVQE

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Francisco-Cruz A, et al. Granulocyte-macrophage colony-stimulating factor: not just another haematopoietic growth factor. Med Oncol. 2014 Jan;31(1):774.  [Content Brief]

  [2]. Gasson JC, et al. Molecular physiology of granulocyte-macrophage colony-stimulating factor. Blood. 1991 Mar 15;77(6):1131-45.  [Content Brief]

  [3]. Hansen PJ, et al. Programming of the preimplantation embryo by the embryokine colony stimulating factor 2. Anim Reprod Sci. 2014 Sep;149(1-2):59-66.  [Content Brief]