GMP KGF/FGF-7 Protein, Human

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. GMP KGF/FGF-7 Protein, Human is the recombinant human-derived KGF/FGF-7 protein, expressed by E. coli , with tag free.

KGF/FGF-7 Protein assumes a crucial role in orchestrating embryonic development, exhibiting regulatory control over fundamental processes encompassing cell proliferation and differentiation. Its essential contribution extends to the intricate realm of normal branching morphogenesis, where KGF/FGF-7 plays a pivotal role. As a growth factor specifically active on keratinocytes, it emerges as a potential major paracrine effector governing normal epithelial cell proliferation. The protein establishes key interactions, forming complexes with FGFBP1 and FGFR2, and its binding affinity with fibroblast growth factors (FGFs) and their receptors is augmented by heparan sulfate glycosaminoglycans, acting as critical coreceptors in these molecular interactions.

Human

E. coli

Tag Free

P21781-1 (C32-T194)

2252

Full Length of Isoform-1 Mature Protein

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 1 mM EDTA, 5% trehalose, 0.02% Tween 80, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/jurkat-cell.html  [Content Brief]