GPR35 Protein, Human (Cell-Free, His)
GPR35 Protein, a receptor for kynurenic acid, operates through G(qi/o) proteins, triggering calcium mobilization and inositol phosphate production. It plays a pivotal role in transducing signals related to tryptophan metabolism, contributing to cellular responses via intricate G-protein signaling pathways. GPR35 Protein, Human (Cell-Free, His) is the recombinant human-derived GPR35 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GPR35 Protein, a receptor for kynurenic acid, operates through G(qi/o) proteins, triggering calcium mobilization and inositol phosphate production. It plays a pivotal role in transducing signals related to tryptophan metabolism, contributing to cellular responses via intricate G-protein signaling pathways. GPR35 Protein, Human (Cell-Free, His) is the recombinant human-derived GPR35 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
GPR35 Protein operates as a receptor for kynurenic acid, a key intermediate in the tryptophan metabolic pathway. Its functional activity is orchestrated by G-proteins, specifically triggering calcium mobilization and inositol phosphate production through G(qi/o) proteins. In this capacity, GPR35 plays a pivotal role in transducing signals related to tryptophan metabolism, contributing to cellular responses mediated by intricate G-protein signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9HC97 (M1-A309)
-
Gene ID2859
-
Molecular Construction
-
N-term
-
10*His
-
GPR35 (M1-A309)
Accession # Q9HC97 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GPR35; Kynurenic Acid Receptor; G Protein-Coupled Receptor 35; KYNA Receptor; G-Protein Coupled Receptor 35
-
AA Sequence
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
-
Predicted Molecular Mass
36.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
