GPR35 Protein, Human (Cell-Free, His)

GPR35 Protein, a receptor for kynurenic acid, operates through G(qi/o) proteins, triggering calcium mobilization and inositol phosphate production. It plays a pivotal role in transducing signals related to tryptophan metabolism, contributing to cellular responses via intricate G-protein signaling pathways. GPR35 Protein, Human (Cell-Free, His) is the recombinant human-derived GPR35 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of GPR35 Protein, Human (Cell-Free, His) is 309 a.a., with molecular weight of 36.9 kDa.

GPR35 Protein operates as a receptor for kynurenic acid, a key intermediate in the tryptophan metabolic pathway. Its functional activity is orchestrated by G-proteins, specifically triggering calcium mobilization and inositol phosphate production through G(qi/o) proteins. In this capacity, GPR35 plays a pivotal role in transducing signals related to tryptophan metabolism, contributing to cellular responses mediated by intricate G-protein signaling pathways.

Human

E. coli Cell-free

N-10*His

Q9HC97 (M1-A309)

2859

MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA

36.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.