Growth Hormone R/GHR Protein, Human (HEK293, His)

Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (HEK293, His) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag.

Growth Hormone R (GHR) functions as the receptor for pituitary gland growth hormone, playing a pivotal role in the regulation of postnatal body growth. Upon binding to its ligand, GHR activates the JAK2/STAT5 pathway, facilitating the intracellular signaling cascade. Additionally, the soluble form of the receptor, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the bloodstream. GHBP may also exert modulatory or inhibitory effects on growth hormone signaling, contributing to the intricate regulation of growth processes.

Human

HEK293

C-8*His

P10912-1 (A27-Y264)

2690

Partial

AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Approximately 45-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.