Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc)

Growth hormone R/GHR protein, as a receptor for pituitary growth hormone, plays a crucial role in regulating postpartum body growth. Ligand binding activates the JAK2/STAT5 pathway, affecting downstream signaling in growth regulation. Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc, C-His labeled tag. The total length of Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc) is 273 a.a., with molecular weight of 70-80 kDa.

Growth Hormone R/GHR Protein functions as the receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon ligand binding, it couples to and activates the JAK2/STAT5 pathway, facilitating downstream signaling events involved in growth regulation. Notably, the soluble form of the receptor, known as GHBP, serves as a reservoir of growth hormone in plasma and exhibits the potential to modulate or inhibit GH signaling, thereby adding a layer of complexity to the finely tuned control of growth processes. The dual role of Growth Hormone R/GHR in mediating growth hormone actions and modulating its signaling highlights its significance in the intricate regulatory mechanisms governing postnatal growth.

Mouse

HEK293

C-hFc;C-His

P16882 (M1-Q273)

14600  [NCBI]

MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQ

70-80 kDa

Greater than 85% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.