Growth Hormone R/GHR Protein, Mouse (HEK293, His)

Growth hormone R/GHR protein, as a receptor for pituitary growth hormone, plays a crucial role in regulating postpartum body growth. Ligand binding activates the JAK2/STAT5 pathway, affecting downstream signaling in growth regulation. Growth Hormone R/GHR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag. The total length of Growth Hormone R/GHR Protein, Mouse (HEK293, His) is 249 a.a., with molecular weight of 40-45 kDa.

Growth Hormone R/GHR Protein functions as the receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon ligand binding, it couples to and activates the JAK2/STAT5 pathway, facilitating downstream signaling events involved in growth regulation. Notably, the soluble form of the receptor, known as GHBP, serves as a reservoir of growth hormone in plasma and exhibits the potential to modulate or inhibit GH signaling, thereby adding a layer of complexity to the finely tuned control of growth processes. The dual role of Growth Hormone R/GHR in mediating growth hormone actions and modulating its signaling highlights its significance in the intricate regulatory mechanisms governing postnatal growth.

Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED₅₀ of this effect is 1.455 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 6.87×10⁵ units/mg.

• 
  Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED₅₀ of this effect is 1.455 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 6.87×10⁵ units/mg.

Mouse

HEK293

C-His

P16882/NP_034414.2 (T25-Q273)

14600  [NCBI]

TPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQ

40-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.