Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc)

GHR Protein, a cell surface receptor, is involved in growth regulation and metabolism. Dysregulation of GHR Protein has been linked to conditions such as growth hormone deficiency and metabolic disorders. Targeting GHR Protein may offer potential therapeutic interventions in these conditions by regulating growth, improving metabolism, and managing related disorders. Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Growth Hormone R/GHR protein, expressed by HEK293, with C-hFc labeled tag. The total length of Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc) is 246 a.a., with molecular weight (glycosylation form) of 65-93 kDa.

The GHR protein, a receptor for pituitary gland growth hormone, plays a crucial role in regulating postnatal body growth. Upon binding to its ligand, GHR activates the JAK2/STAT5 pathway, thereby initiating downstream signaling events. Additionally, the soluble form of GHR, known as GHBP, functions as a reservoir for growth hormone in the plasma and may serve as a modulator or inhibitor of GH signaling.

Measured in a cell proliferation assay using NB2-11 cells. The ED₅₀ for this effect is 0.8665 ng/mL in the presence of 0.2 ng/mL of rhGH, corresponding to a specific activity is 1.15×10^6 units/mg.

• 
  Measured in a cell proliferation assay using NB2-11 cells. The ED₅₀ this effect is 0.8665 ng/mL in the presence of 0.2 ng/mL of rhGH, corresponding to a specific activity is 1.15×10⁶units/mg

Rhesus Macaque

HEK293

C-hFc

P79194-1 (F19-Y264)

697986  [NCBI]

FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY

65-93 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.