GRX1/Glutaredoxin 1 Protein, Human (His)
Based on 1 Customer Validation
GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.
Background
GRX1 (Glutaredoxin 1) demonstrates glutathione-disulfide oxidoreductase activity when NADPH and glutathione reductase are present. It functions to reduce both low molecular weight disulfides and proteins.
Verified Bioactivity
Measured by its ability to catalyze substrate eosin-GS-BSA product eosin-GSH that incubate at room temperature in kinetic for 10 min. The specific activity is 9.773 μM/min.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P35754 (M1-Q106)
-
Molecular Construction
-
N-term
-
His
-
GRX1 (M1-Q106)
Accession # P35754 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GLRX; Thioltransferase-1; Glutaredoxin; Thioltransferase; GRX; TTase-1; Glutaredoxin-1; Glutaredoxin (Thioltransferase); GRX1
-
AA Sequence
MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
-
Molecular Weight
Approximately 12-12 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 500 mM arginine, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
