1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GRX1/Glutaredoxin 1 Protein, Human (His)

GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.

Background

GRX1 (Glutaredoxin 1) demonstrates glutathione-disulfide oxidoreductase activity when NADPH and glutathione reductase are present. It functions to reduce both low molecular weight disulfides and proteins.

Biological Activity

Measured by its ability to catalyze substrate eosin-GS-BSA product eosin-GSH that incubate at room temperature in kinetic for 10 min. The specific activity is 9.773 μM/min.

Species

Human

Source

E. coli

Tag

N-His

Accession

P35754 (M1-Q106)

Gene ID
Molecular Construction
N-term
His
GRX1 (M1-Q106)
Accession # P35754
C-term
Protein Length

Full Length

Synonyms
Glutaredoxin-1; Thioltransferase-1; TTase-1; GLRX; GRX
AA Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

분자량

Approximately 12-12 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

GRX1/Glutaredoxin 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

GRX1/Glutaredoxin 1 Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
GRX1/Glutaredoxin 1 Protein, Human (His)
Cat. No.:
HY-P76366
수량:
MCE Japan Authorized Agent: