GRX1/Glutaredoxin 1 Protein, Human (His)
Based on 1 Customer Validation
GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.
GRX1 (Glutaredoxin 1) demonstrates glutathione-disulfide oxidoreductase activity when NADPH and glutathione reductase are present. It functions to reduce both low molecular weight disulfides and proteins.
Measured by its ability to catalyze substrate eosin-GS-BSA product eosin-GSH that incubate at room temperature in kinetic for 10 min. The specific activity is 9.773 μM/min.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P35754 (M1-Q106)
-
Molecular Construction
-
N-term
-
His
-
GRX1 (M1-Q106)
Accession # P35754 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GLRX; Thioltransferase-1; Glutaredoxin; Thioltransferase; GRX; TTase-1; Glutaredoxin-1; Glutaredoxin (Thioltransferase); GRX1
-
AA Sequence
MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
-
Molecular Weight
Approximately 12-12 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 500 mM arginine, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
