1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GRX1/Glutaredoxin 1 Protein, Human (His)

GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.

Background

GRX1 (Glutaredoxin 1) demonstrates glutathione-disulfide oxidoreductase activity when NADPH and glutathione reductase are present. It functions to reduce both low molecular weight disulfides and proteins.

Actividad biológica

Measured by its ability to catalyze substrate eosin-GS-BSA product eosin-GSH that incubate at room temperature in kinetic for 10 min. The specific activity is 9.773 μM/min.

Species

Human

Source

E. coli

Tag

N-His

Accession

P35754 (M1-Q106)

Gene ID
Molecular Construction
N-term
His
GRX1 (M1-Q106)
Accession # P35754
C-term
Protein Length

Full Length

Synonyms
Glutaredoxin-1; Thioltransferase-1; TTase-1; GLRX; GRX
AA Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

Peso molecular

Approximately 14 kDa.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias

GRX1/Glutaredoxin 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

GRX1/Glutaredoxin 1 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
GRX1/Glutaredoxin 1 Protein, Human (His)
Cat. No.:
HY-P76366
Cantidad:
MCE Japan Authorized Agent: