H2AC4 Protein, Human
The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free.
Background
H2AC4 protein serves as a core component of the nucleosome, an integral structure that envelops and compacts DNA into chromatin, effectively restricting DNA accessibility to cellular machineries requiring DNA as a template. Histones, including H2AC4, assume a pivotal role in key cellular processes such as transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a complex network of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome itself comprises a histone octamer, consisting of two molecules each of H2A, H2B, H3, and H4, arranged in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, underscoring its fundamental role in organizing chromatin structure and facilitating genomic functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P04908 (S2-K130)
-
Molecular Construction
-
N-term
-
H2AC4 (S2-K130)
Accession # P04908 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
H2AC4; Histone H2A Type 1-B/E; Prev. HIST1H2AB; Histone H2A/M; Prev. H2AFM; HIST1H2AE; H2A/M; Histone H2A/A; Histone Cluster 1 H2A Family Member B; Histone H2A.2; H2A Histone Family, Member M; Histone H2A; Histone Cluster 1, H2ab; H2AFA; H2A Clustered His
-
AA Sequence
SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)