H2AC4 Protein, Human

The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free.

Background

H2AC4 protein serves as a core component of the nucleosome, an integral structure that envelops and compacts DNA into chromatin, effectively restricting DNA accessibility to cellular machineries requiring DNA as a template. Histones, including H2AC4, assume a pivotal role in key cellular processes such as transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a complex network of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome itself comprises a histone octamer, consisting of two molecules each of H2A, H2B, H3, and H4, arranged in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, underscoring its fundamental role in organizing chromatin structure and facilitating genomic functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • H2AC4 (S2-K130)
      Accession # P04908
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    H2AC4; Histone H2A Type 1-B/E; Prev. HIST1H2AB; Histone H2A/M; Prev. H2AFM; HIST1H2AE; H2A/M; Histone H2A/A; Histone Cluster 1 H2A Family Member B; Histone H2A.2; H2A Histone Family, Member M; Histone H2A; Histone Cluster 1, H2ab; H2AFA; H2A Clustered His

  • AA Sequence

    SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00