1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Hemagglutinin
  5. HA/Hemagglutinin Protein, H1N1 (AFR76582, HEK293, His)

HA/Hemagglutinin Protein, H1N1 (AFR76582, HEK293, His)

Cat. No.: HY-P74049
Handling Instructions Technical Support

The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis.HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions.HA/Hemagglutinin Protein, H1N1 (AFR76582, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis.HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions.HA/Hemagglutinin Protein, H1N1 (AFR76582, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

Background

The Hemagglutinin (HA) protein plays a crucial role in the attachment of virus particles to host cells by binding to sialic acid-containing receptors on the cell surface. This interaction not only induces virion internalization through clathrin-dependent endocytosis but also facilitates an alternative clathrin- and caveolin-independent pathway for about one-third of the virus particles. HA is a Class I viral fusion protein responsible for penetrating the cell cytoplasm by mediating the fusion of the virus particle's membrane with the endosomal membrane. The low pH environment in endosomes triggers an irreversible conformational change in HA2, leading to the release of the fusion hydrophobic peptide. The cooperative action of several trimers is necessary to form a competent fusion pore, highlighting the intricate role of HA in host range restriction and virulence determination.

Species

Virus

Source

HEK293

Tag

C-His

Accession

AFR76582 (A17-S524)

Gene ID

/

Molecular Construction
N-term
H1N1 HA (A17-S524)
Accession # AFR76582
His
C-term
Protein Length

Partial

Synonyms
HA; Hemagglutinin; HA/Hemagglutinin Protein, H1N1 (A/swine/OMS/2112/1995, HEK293, His)
AA Sequence

ADTICVGYHANNSTDTVDTILEKNVTVTHSVNLLENNHNGKLCSLNGIAPLQLGDCNVAGWILGNPECDSLLTANSWSYIIETSNSENGTCYPGEFADYEELRELLSSVSSFERFEIFPKATSWPNHETTKGVTAACSHSGARSFYRNLLWIVKKGNSYPKLSKSYTNNRRKEVLVIWGVHHPPTNNDQQSLYQNADAYVSVGSSKYYRRFTPEIADRPKVRGQAGRMNYYWTMLDQGDTITFEATGNLIAPWYAFALNKGLSSGIIMSDAPVHNCTTRCQTPYGALNSNLPFQNVHPITIGKCPKYVKSTQLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAIDGISNKVNSIIEKMNIQFTSVGKEFNDLEKRVENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDFNVRNLYEKVKSQLRNNAKEVGNGCFEFYHKCDDECMESVRNGTYNYPKYSEESKLNREKIDGVKLES

Predicted Molecular Mass
58.6 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HA/Hemagglutinin Protein, H1N1 (AFR76582, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HA/Hemagglutinin Protein, H1N1 (AFR76582, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HA/Hemagglutinin Protein, H1N1 (AFR76582, HEK293, His)
Cat. No.:
HY-P74049
Quantity:
MCE Japan Authorized Agent: