1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Hemagglutinin
  5. HA1/Hemagglutinin Protein, Influenza B (ACN29383, HEK293, His)

HA1/Hemagglutinin Protein, Influenza B (ACN29383, HEK293, His)

Cat. No.: HY-P73945
Handling Instructions Technical Support

The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis. HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions. HA/Hemagglutinin Protein, Influenza B (ACN29383, 362a.a, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis. HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions. HA/Hemagglutinin Protein, Influenza B (ACN29383, 362a.a, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

Background

The Hemagglutinin (HA) protein plays a crucial role in the attachment of virus particles to host cells by binding to sialic acid-containing receptors on the cell surface. This interaction not only induces virion internalization through clathrin-dependent endocytosis but also facilitates an alternative clathrin- and caveolin-independent pathway for about one-third of the virus particles. HA is a Class I viral fusion protein responsible for penetrating the cell cytoplasm by mediating the fusion of the virus particle's membrane with the endosomal membrane. The low pH environment in endosomes triggers an irreversible conformational change in HA2, leading to the release of the fusion hydrophobic peptide. The cooperative action of several trimers is necessary to form a competent fusion pore, highlighting the intricate role of HA in host range restriction and virulence determination.

Species

Virus

Source

HEK293

Tag

C-His

Accession

ACN29383 (D16-R362)

Gene ID

/

Molecular Construction
N-term
HA1/Hemagglutinin (D16-R362)
Accession # ACN29383
His
C-term
Protein Length

Partial

Synonyms
HA; Hemagglutinin; HA/Hemagglutinin Protein, Influenza B (B/Brisbane/60/2008, 362a.a, HEK293, His)
AA Sequence

DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSHFANLKGTETRGKLCPKCLNCTDLDVALGRPKCTGKIPSARVSILHEVRPVTSGCFPIMHDRTKIRQLPNLLRGYEHIRLSTHNVINAENAPGGPYKIGTSGSCPNITNGNGFFATMAWAVPKNDKNKTATNPLTIEVPYICTEGEDQITVWGFHSDNETQMAKLYGDSKPQKFTSSANGVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKSGKTGTITYQRGILLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYGGLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKER

Predicted Molecular Mass
39.1 kDa
분자량

Approximately 66 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

HA1/Hemagglutinin Protein, Influenza B (ACN29383, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

HA1/Hemagglutinin Protein, Influenza B (ACN29383, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
HA1/Hemagglutinin Protein, Influenza B (ACN29383, HEK293, His)
Cat. No.:
HY-P73945
수량:
MCE Japan Authorized Agent: