1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Hemagglutinin
  5. HA1/Hemagglutinin Protein, Influenza B (ACO05957, HEK293, His)

HA1/Hemagglutinin Protein, Influenza B (ACO05957, HEK293, His)

Cat. No.: HY-P73944
Handling Instructions Technical Support

Hemagglutinin (HA) is a class I viral fusion protein which is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. HA binds to sialic acid-containing receptors on the cell surface to bring about the attachment of the virus particle to the cell. The attachment of HA induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. HA plays a major role in the determination of host range restriction and virulence. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide and forming fusion pore. Several HA trimers are required to form a competent fusion pore. HA/Hemagglutinin Protein, Influenza B (ACO05957, 362a.a, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Hemagglutinin (HA) is a class I viral fusion protein which is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. HA binds to sialic acid-containing receptors on the cell surface to bring about the attachment of the virus particle to the cell. The attachment of HA induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. HA plays a major role in the determination of host range restriction and virulence. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide and forming fusion pore. Several HA trimers are required to form a competent fusion pore[1][2]. HA/Hemagglutinin Protein, Influenza B (ACO05957, 362a.a, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

Background

Hemagglutinin (HA) is a class I viral fusion protein which is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. HA binds to sialic acid-containing receptors on the cell surface to bring about the attachment of the virus particle to the cell, and plays a major role in the determination of host range restriction and virulence.

Species

Virus

Source

HEK293

Tag

C-His

Accession

ACO05957 (D16-R362)

Gene ID

/

Molecular Construction
N-term
HA1/Hemagglutinin (D16-R362)
Accession # ACO05957
His
C-term
Protein Length

Partial

Synonyms
HA; Hemagglutinin; HA/Hemagglutinin, Influenza B (B/Malaysia/2506/2004, 362a.a, HEK293, His)
AA Sequence

DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSHFANLKGTETRGKLCPKCLNCTDLDVALGRPKCTGNIPSARVSILHEVRPVTSGCFPIMHDRTKIRQLPNLLRGYEHIRLSTHNVINAENAPGGPYKIGTSGSCPNVTNGNGFFATMAWAVPKNDNNKTATNSLTIEVPYICTEGEDQITVWGFHSDNEIQMAKLYGDSKPQKFTSSANGVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKSGKTGTITYQRGILLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYGGLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKER

Predicted Molecular Mass
39 kDa
Molecular Weight

Approximately 55-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

HA1/Hemagglutinin Protein, Influenza B (ACO05957, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HA1/Hemagglutinin Protein, Influenza B (ACO05957, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HA1/Hemagglutinin Protein, Influenza B (ACO05957, HEK293, His)
Cat. No.:
HY-P73944
Quantity:
MCE Japan Authorized Agent: