2. Recombinant Proteins
  3. Viral Proteins
  4. Influenza Viruses Proteins
  5. Influenza Hemagglutinin
  6. HA1/Hemagglutinin Protein, Influenza B (AGI64446, HEK293, His)

HA1/Hemagglutinin Protein, Influenza B (AGI64446, HEK293, His)

Cat. No.: HY-P73939
Handling Instructions Technical Support

The Angiopoietin-1 Protein is a secreted glycoprotein that is a key ligand in the vascular tyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells. HA/Hemagglutinin Protein, Influenza B (AGI64446, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The Angiopoietin-1 Protein is a secreted glycoprotein that is a key ligand in the vascular tyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells. HA/Hemagglutinin Protein, Influenza B (AGI64446, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.
Background

ANGPT1 encodes a secreted glycoprotein in the angiopoietin family and is a key ligand in the vasotyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. The Angiopoietin-1 Protein regulates the formation and stability of blood vessels and plays an important role in vascular development. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells[1][2][3].
Species

Virus
Source

HEK293
Tag

C-His
Accession

AGI64446 (D16-R362)
Gene ID

/
Molecular Construction
N-term
HA1/Hemagglutinin (D16-R362)
Accession # AGI64446
His
C-term
Protein Length

Partial
Synonyms
HA; Hemagglutinin; HA/Hemagglutinin, Influenza B (B/Massachusetts/03/2010, HEK293, His)
AA Sequence

DRICTGITSSNSPHIVKTATQGEVNVTGVIPLTTTPTKSHFANLKGTETRGKLCPKCLNCTDLDVALGRPKCTGKIPSARVSILHEVRPVTSGCFPIMHDRTKIRQLPNLLRGYEHIRLSTHNVINAENAPGGPYKIGTSGSCPNITNGNGFFATMAWAVPKNDKNKTATNPLTIEVPYICTEGEDQITVWGFHSDNETQMAKLYGDSKPQKFTSSANGVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKSGKTGTITYQRGILLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYGGLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKER

Predicted Molecular Mass
39.1 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
각종 서류
Handling Instructions (2659 KB)

HA1/Hemagglutinin Protein, Influenza B (AGI64446, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

HA1/Hemagglutinin Protein, Influenza B (AGI64446, HEK293, His)

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
HA1/Hemagglutinin Protein, Influenza B (AGI64446, HEK293, His)
Cat. No.:
HY-P73939
수량:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

Country or Region *

메일주소 *

     

전화번호 *

 

회사명 *

비고

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.