HADHB Protein, Human (GST)
Based on 1 Customer Validation
HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.
HADHB protein serves as an integral component of the mitochondrial trifunctional enzyme, orchestrating the final three reactions within the mitochondrial beta-oxidation pathway. This crucial pathway is paramount for energy production in various tissues, breaking down fatty acids into acetyl-CoA through a series of four consecutive reactions. Specifically tailored for long-chain fatty acids, the trifunctional enzyme operates as a heterotetrameric complex composed of two distinct subunits. HADHA, carrying 2,3-enoyl-CoA hydratase and 3-hydroxyacyl-CoA dehydrogenase activities, partners with HADHB, the focus here, which houses the 3-ketoacyl-CoA thiolase activity. This intricate collaboration underscores HADHB's pivotal role in driving the final steps of mitochondrial beta-oxidation, contributing to energy homeostasis in cellular metabolism.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P55084-1 (A35-P283)
-
Molecular Construction
-
N-term
-
GST
-
HADHB (A35-P283)
Accession # P55084-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HADHB; 2-Enoyl-Coenzyme A (CoA) Hydratase, Beta Subunit; Hydroxyacyl-CoA Dehydrogenase Trifunctional Multienzyme Complex Subunit Beta; Acetyl-CoA Acyltransferase; Trifunctional Enzyme Subunit Beta, Mitochondrial; Beta-Ketothiolase; MTPB; TP-BETA; Hydroxya
-
AA Sequence
APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP
-
Predicted Molecular Mass
53.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
