1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. HADHB Protein, Human (GST)

HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.

Background

HADHB protein serves as an integral component of the mitochondrial trifunctional enzyme, orchestrating the final three reactions within the mitochondrial beta-oxidation pathway. This crucial pathway is paramount for energy production in various tissues, breaking down fatty acids into acetyl-CoA through a series of four consecutive reactions. Specifically tailored for long-chain fatty acids, the trifunctional enzyme operates as a heterotetrameric complex composed of two distinct subunits. HADHA, carrying 2,3-enoyl-CoA hydratase and 3-hydroxyacyl-CoA dehydrogenase activities, partners with HADHB, the focus here, which houses the 3-ketoacyl-CoA thiolase activity. This intricate collaboration underscores HADHB's pivotal role in driving the final steps of mitochondrial beta-oxidation, contributing to energy homeostasis in cellular metabolism.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P55084-1 (A35-P283)

Gene ID
Molecular Construction
N-term
GST
HADHB (A35-P283)
Accession # P55084-1
C-term
Protein Length

Partial

Synonyms
3-ketoacyl-CoA thiolase; Acetyl CoA acyltransferase; Acetyl-CoA acyltransferase; Beta ketothiolase; Beta-ketothiolase; ECHB; ECHB_HUMAN; HADH; Hadhb; beta subunit; Hydroxyacyl Coenzyme A (CoA) dehydrogenase beta subunit; MGC87480; MSTP 029; MSTP029; MTPB; TP beta; TP-beta; TPbeta; Trifunctional enzyme subunit beta; Trifunct
AA Sequence

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Molecular Weight

Approximately 53.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HADHB Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HADHB Protein, Human (GST)
Cat. No.:
HY-P71471
Quantity:
MCE Japan Authorized Agent: