1. Recombinant Proteins
  2. Enzymes & Regulators Viral Proteins
  3. Hydrolases (EC 3)
  4. HCoV-OC43 Hemagglutinin esterase Protein (HEK293, His)

HCoV-OC43 Hemagglutinin esterase Protein (HEK293, His)

Cat. No.: HY-P77384
Handling Instructions Technical Support

HCoV-OC43 is a type of coronavirus 1 that infects humans and cattle. HCoV-OC43 forms a spiky structural protein on the surface of the virus, contains receptor binding and receptor destruction activities, and mediates the deacetylation of n-acetyl-4-o-acetylneuraminic acid. HCoV-OC43 Hemagglutinin esterase Protein (HEK293, His) is the recombinant Virus-derived HCoV-OC43 Hemagglutinin esterase protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HCoV-OC43 is a type of coronavirus 1 that infects humans and cattle. HCoV-OC43 forms a spiky structural protein on the surface of the virus, contains receptor binding and receptor destruction activities, and mediates the deacetylation of n-acetyl-4-o-acetylneuraminic acid. HCoV-OC43 Hemagglutinin esterase Protein (HEK293, His) is the recombinant Virus-derived HCoV-OC43 Hemagglutinin esterase protein, expressed by HEK293 , with C-His labeled tag.

Background

HCoV-OC43 is a type of coronavirus 1 that infects humans and cattle. The infected coronavirus is a coated, righteous single-stranded RNA virus that enters the host cell by binding to the n-acetyl-9-o-acetylneuraminic acid receptor. HCoV-OC43 forms a spiky structural protein on the surface of the virus, contains receptor binding and receptor destruction activities, and mediates the deacetylation of n-acetyl-4-o-acetylneuraminic acid. HCoV-OC43 is also one of the viruses that cause the common cold and can cause serious lower respiratory infections, including pneumonia in infants, the elderly, and immunocompromised people[1][2][3].

Species

Virus

Source

HEK293

Tag

C-His

Accession

APU51943 (L17-P394)

Gene ID

/

Molecular Construction
N-term
HCoV-OC43 HE (L17-P394)
Accession # APU51943
His
C-term
Protein Length

Partial

Synonyms
Human coronAvirus (HCoV-OC43) Hemagglutinin esterase Protein (His)
AA Sequence

LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPALCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVSYVYNGSAQATSFCKSGSKLKNLVLNNPAYIAPQAKSGIITKVEADFYLSGCDEYIVPLCIFNGKSLSNTKYYDHSQYYFNKDTGVIYGLNSTETITTSFDLNCHYLVLPSGNYLAISNELLLTVPTKAICFNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYNSSCFSQQGVFRYDNISSVWPLYPYGRCPTAAYINIPDLPICVYDPLP

Predicted Molecular Mass
44 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HCoV-OC43 Hemagglutinin esterase Protein (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HCoV-OC43 Hemagglutinin esterase Protein (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCoV-OC43 Hemagglutinin esterase Protein (HEK293, His)
Cat. No.:
HY-P77384
Quantity:
MCE Japan Authorized Agent: