1. Recombinant Proteins
  2. Others
  3. HE4/WFDC2 Protein, Canine (HEK293, Fc)

HE4/WFDC2 Protein, Canine (HEK293, Fc)

Cat. No.: HY-P75803
COA Handling Instructions

HE4/WFDC2 protein acts as a broad-spectrum protease inhibitor and may affect a variety of cellular processes. Its effect on sperm maturation suggests its role in reproductive mechanisms. HE4/WFDC2 Protein, Canine (HEK293, Fc) is the recombinant canine-derived HE4/WFDC2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of HE4/WFDC2 Protein, Canine (HEK293, Fc) is 97 a.a., with molecular weight of ~43-50 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

HE4/WFDC2 Protein, Canine (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HE4/WFDC2 protein acts as a broad-spectrum protease inhibitor and may affect a variety of cellular processes. Its effect on sperm maturation suggests its role in reproductive mechanisms. HE4/WFDC2 Protein, Canine (HEK293, Fc) is the recombinant canine-derived HE4/WFDC2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of HE4/WFDC2 Protein, Canine (HEK293, Fc) is 97 a.a., with molecular weight of ~43-50 kDa.

Background

HE4/WFDC2 Protein serves as a broad-spectrum protease inhibitor, potentially contributing to diverse cellular processes. Its putative role in sperm maturation suggests involvement in reproductive mechanisms. Structurally, it forms a homotrimer through disulfide linkages, highlighting its oligomeric nature. The multifaceted function of HE4/WFDC2 in protease regulation and potential impact on reproductive processes underscores its significance in cellular homeostasis.

Species

Canine

Source

HEK293

Tag

C-hFc

Accession

Q28894/NP_001003241.1 (G28-F124)

Gene ID

403919  [NCBI]

Molecular Construction
N-term
HE4 (G28-F124)
Accession # Q28894/NP_001003241.1
hFc
C-term
Synonyms
WAP four-disulfide core domain protein 2; CE4; WFDC2
AA Sequence

GEVEKTGVCPQLQADLNCTQECVSDAQCADNLKCCQAGCATICHLPNEKEGSCPQVNTDFPQLGLCQDQCQVDSHCPGLLKCCYNGCGKVSCVTPIF

Molecular Weight

Approximately 43-50 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HE4/WFDC2 Protein, Canine (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HE4/WFDC2 Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P75803
Quantity:
MCE Japan Authorized Agent: