1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Hemagglutinin
  5. HA1/Hemagglutinin Protein, H17N10 (AFC35418, HEK293, His)

HA1/Hemagglutinin Protein, H17N10 (AFC35418, HEK293, His)

Cat. No.: HY-P77024
Handling Instructions Technical Support

The hemagglutinin (HA) protein is essential for viral attachment to host cells, binding to sialic acid receptors, and initiating virion internalization through clathrin-dependent or -independent pathways. As a class I viral fusion protein, HA determines host range and virulence, mediating viral penetration into the cytoplasm. Hemagglutinin/HA Protein, H17N10 (AFC35418, HEK293, His) is the recombinant Virus-derived Hemagglutinin/HA protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The hemagglutinin (HA) protein is essential for viral attachment to host cells, binding to sialic acid receptors, and initiating virion internalization through clathrin-dependent or -independent pathways. As a class I viral fusion protein, HA determines host range and virulence, mediating viral penetration into the cytoplasm. Hemagglutinin/HA Protein, H17N10 (AFC35418, HEK293, His) is the recombinant Virus-derived Hemagglutinin/HA protein, expressed by HEK293 , with C-His labeled tag.

Background

The Hemagglutinin (HA) protein is central to the attachment of virus particles to host cells by binding to sialic acid-containing receptors on the cell surface. This interaction leads to virion internalization through either clathrin-dependent endocytosis or a clathrin- and caveolin-independent pathway. HA plays a pivotal role in determining host range restriction and virulence, functioning as a Class I viral fusion protein responsible for the penetration of the virus into the cell cytoplasm. Its mediation of the fusion between the membrane of the endocytosed virus particle and the endosomal membrane is essential for successful infection. The acidic environment in endosomes induces an irreversible conformational change in the HA2 subunit, releasing the fusion hydrophobic peptide. The formation of a competent fusion pore requires the cooperative action of several HA trimers, highlighting the intricate molecular processes orchestrated by HA during viral entry.

Species

Virus

Source

HEK293

Tag

C-His

Accession

AFC35418 (D19-R342)

Gene ID

/

Molecular Construction
N-term
HA1/Hemagglutinin (D19-R342)
Accession # AFC35418
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Influenza A H17N10 (A/little yellow-shouldered bat/Guatemala/164/2009) Hemagglutinin Protein (His)
AA Sequence

DRICIGYQANQNNQTVNTLLEQNVPVTGAQEILETNHNGKLCSLNGVPPLDLQSCTLAGWLLGNPNCDSLLEAEEWSYIKINESAPDDLCFPGNFENLQDLLLEMSGVQNFTKVKLFNPQSMTGVTTNNVDQTCPFEGKPSFYRNLNWIQGNSGLPFNIEIKNPTSNPLLLLWGIHNTKDAAQQRNLYGNDYSYTIFNFGEKSEEFRPEIGQRDEVKAHQDRIDYYWGSLPAQSTLRIESTGNLIAPEYGFYYKRKEGKGGLMKSKLPISDCSTKCQTPLGALNSTLPFQNVHQQTIGNCPKYVKATSLMLATGLRNNPQMEGR

Predicted Molecular Mass
37.7 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

HA1/Hemagglutinin Protein, H17N10 (AFC35418, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

HA1/Hemagglutinin Protein, H17N10 (AFC35418, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
HA1/Hemagglutinin Protein, H17N10 (AFC35418, HEK293, His)
Cat. No.:
HY-P77024
수량:
MCE Japan Authorized Agent: