1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Hemagglutinin
  5. HA1/Hemagglutinin Protein, H12N3 (ACV86810, HEK293, His)

HA1/Hemagglutinin Protein, H12N3 (ACV86810, HEK293, His)

Cat. No.: HY-P75004
Handling Instructions Technical Support

The hemagglutinin HA1 protein is essential for attachment of virions to host cells by binding to sialic acid-containing receptors, inducing virion internalization via clathrin-dependent or clathrin- and caveolin-independent pathways. As a class I viral fusion protein, HA1 determines host range restriction and virulence, mediating fusion between the virion membrane and the endosomal membrane. HA1/Hemagglutinin Protein, H12N3 (ACV86810, HEK293, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The hemagglutinin HA1 protein is essential for attachment of virions to host cells by binding to sialic acid-containing receptors, inducing virion internalization via clathrin-dependent or clathrin- and caveolin-independent pathways. As a class I viral fusion protein, HA1 determines host range restriction and virulence, mediating fusion between the virion membrane and the endosomal membrane. HA1/Hemagglutinin Protein, H12N3 (ACV86810, HEK293, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

Background

The Hemagglutinin HA1 protein is instrumental in the attachment of virus particles to host cells by binding to sialic acid-containing receptors on the cell surface. This attachment triggers virion internalization through either clathrin-dependent endocytosis or a clathrin- and caveolin-independent pathway. HA1 plays a crucial role in determining host range restriction and virulence, functioning as a Class I viral fusion protein that facilitates the penetration of the virus into the cell cytoplasm by mediating the fusion of the endocytosed virus particle's membrane with the endosomal membrane. The low pH environment in endosomes induces an irreversible conformational change in HA2, leading to the release of the fusion hydrophobic peptide. The formation of a competent fusion pore requires the cooperative action of several trimers, underscoring the intricate mechanisms by which HA1 contributes to viral entry and infection.

Species

Virus

Source

HEK293

Tag

C-His

Accession

ACV86810.1 (Y17-R342)

Gene ID

/

Molecular Construction
N-term
HA1/Hemagglutinin (Y17-R342)
Accession # ACV86810.1
His
C-term
Protein Length

Partial

Synonyms
Influenza A H12N3 (A/bar headed goose/Mongolia/143/2005) Hemagglutinin / HA1 Protein (His)
AA Sequence

YDKICIGYQTNNSTDTVNTLIEQNVPVTQVEELVHGQVNPILCGTELGSPLVLDDCSLEGLILGNPKCDPYLNGREWSYIVERPKEMEGICYPGSIENQEELRSLFSSIKKYERVKMFDFTKWNVTYTGTSKACNNTSNQGSFYRSIRWLTLKSGQFPVQTDEYKNTRDSDIVFTWAIHHPPTTDEQMKLYKNSDTLSSVTTDEINRSFRPNIGPRPLVRGQQGRMDYYWAVLKPGQTVKIQTNGNLIAPEYGHLITGKSHGRILKNDLPVGQCTTECQLNEGVMNTSKPFQNTSKHYIGKCPKYIPSNSLKLAIGLRNVPQVQDR

Predicted Molecular Mass
38.4 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HA1/Hemagglutinin Protein, H12N3 (ACV86810, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HA1/Hemagglutinin Protein, H12N3 (ACV86810, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HA1/Hemagglutinin Protein, H12N3 (ACV86810, HEK293, His)
Cat. No.:
HY-P75004
Quantity:
MCE Japan Authorized Agent: