1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Hemagglutinin
  5. HA1/Hemagglutinin Protein, H12N5 (ABB88110, HEK293, His)

HA1/Hemagglutinin Protein, H12N5 (ABB88110, HEK293, His)

Cat. No.: HY-P75003
Instrucciones de manejo Technical Support

The hemagglutinin HA1 protein is essential for attachment of virions to host cells by binding to sialic acid-containing receptors, inducing virion internalization via clathrin-dependent or clathrin- and caveolin-independent pathways.As a class I viral fusion protein, HA1 determines host range restriction and virulence, mediating fusion between the virion membrane and the endosomal membrane.HA1/Hemagglutinin Protein, H12N5 (ABB88110, HEK293, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The hemagglutinin HA1 protein is essential for attachment of virions to host cells by binding to sialic acid-containing receptors, inducing virion internalization via clathrin-dependent or clathrin- and caveolin-independent pathways.As a class I viral fusion protein, HA1 determines host range restriction and virulence, mediating fusion between the virion membrane and the endosomal membrane.HA1/Hemagglutinin Protein, H12N5 (ABB88110, HEK293, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

Background

The Hemagglutinin HA1 protein is instrumental in the attachment of virus particles to host cells by binding to sialic acid-containing receptors on the cell surface. This attachment triggers virion internalization through either clathrin-dependent endocytosis or a clathrin- and caveolin-independent pathway. HA1 plays a crucial role in determining host range restriction and virulence, functioning as a Class I viral fusion protein that facilitates the penetration of the virus into the cell cytoplasm by mediating the fusion of the endocytosed virus particle's membrane with the endosomal membrane. The low pH environment in endosomes induces an irreversible conformational change in HA2, leading to the release of the fusion hydrophobic peptide. The formation of a competent fusion pore requires the cooperative action of several trimers, underscoring the intricate mechanisms by which HA1 contributes to viral entry and infection.

Species

Virus

Source

HEK293

Tag

C-His

Accession

ABB88110 (D18-R342)

Gene ID

/

Molecular Construction
N-term
HA1/Hemagglutinin (D18-R342)
Accession # ABB88110
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Influenza A H12N5 (A/green-winged teal/ALB/199/1991) Hemagglutinin Protein (HA1 Subunit) (His)
AA Sequence

DKICIGYQTNNSTETVNTLIEQNVPVTQVEELVHGGIDPILCGTELGSPLVLDDCSLEGLILGNPKCDLYLNGREWSYIVERPKEMEGVCYPGSIENQEELRSLFSSIKKYERVKMFDFTKWNVTYTGTSKACNNTSNQGSFYRSMRWLTLKSGQFPVQTDEYKNTRDSDIVFTWAIHHPPTSDEQVKLYKNPDTLSSVTTDEINRSFKPNIGPRPLVRGQQGRMDYYWAVLKPGQTVKIQTNGNLIAPEYGHLITGKSHGRILKNNLPIGQCVTECQLNEGVMNTSKPFQNTSKHYIGKCPKYIPSGSLKLAIGLRNVPQVQDR

Predicted Molecular Mass
38.2 kDa
Peso molecular

Approximately 50-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

HA1/Hemagglutinin Protein, H12N5 (ABB88110, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

HA1/Hemagglutinin Protein, H12N5 (ABB88110, HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
HA1/Hemagglutinin Protein, H12N5 (ABB88110, HEK293, His)
Cat. No.:
HY-P75003
Cantidad:
MCE Japan Authorized Agent: