HA1/Hemagglutinin Protein, H4N8 (P19695, HEK293, His)

HA1/Hemagglutinin Protein, binding to cell surface receptors, facilitates virus attachment.It leads to internalization via endocytosis.HA1 determines host range and virulence, mediating fusion of virus and endosomal membrane.Low pH triggers HA2 conformational change, releasing fusion peptide.Multiple HA trimers form fusion pore.HA1/Hemagglutinin Protein, H4N8 (P19695, HEK293, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag.

The HA1 protein, also known as Hemagglutinin, binds to sialic acid-containing receptors on the cell surface, facilitating the attachment of the virus particle to the cell. This attachment leads to the internalization of about two thirds of the virus particles through clathrin-dependent endocytosis and approximately one third through a clathrin- and caveolin-independent pathway. HA1 also plays a crucial role in determining the host range restriction and virulence of the virus. As a class I viral fusion protein, it is responsible for penetrating the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. The low pH environment in endosomes triggers an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. The formation of a competent fusion pore requires multiple trimers of HA.

Virus

HEK293

C-His

P19695 (Q17-R343)

/

Full Length of HA1 chain

QNYTGNPVICLGHHAVSNGTMVKTLTDDQVEVVTAQELVESQHLPELCPSPLRLVDGQTCDIVNGALGSPGCNHLNGAEWDVFIERPTAVDTCYPFDVPDYQSLRSILANNGKFEFIVEKFQWNTVKQNGKSGACKRANENDFFTNLNWLTKSDGNAYPLQNLTKVNNGDYARLYIWGVHHPSTDTEQTNLYENNPGRVTVSTKTSQTSVVPNIGSRPWVRGQSGRISFYWTIVEPGDIIVFNTIGNLIAPRGHYKLNSQKKSTILNTAVPIGSCVSKCHTDRGSITTTKPFQNISRISIGDCPKYVKQGSLKLATGMRNIPEKATR

Approximately 55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.