HGPRT Protein, Human (His)
HGPRT proteins play a key role in purine metabolism, promoting the conversion of guanine to guanosine monophosphate and hypoxanthine to inosine monophosphate. Through its enzymatic activity, HGPRT transfers the 5-phosphate ribosyl group from 5-phosphate ribose pyrophosphate to purine, making a significant contribution to the purine salvage pathway. HGPRT Protein, Human (His) is the recombinant human-derived HGPRT protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HGPRT proteins play a key role in purine metabolism, promoting the conversion of guanine to guanosine monophosphate and hypoxanthine to inosine monophosphate. Through its enzymatic activity, HGPRT transfers the 5-phosphate ribosyl group from 5-phosphate ribose pyrophosphate to purine, making a significant contribution to the purine salvage pathway. HGPRT Protein, Human (His) is the recombinant human-derived HGPRT protein, expressed by E. coli , with N-6*His labeled tag.
The HGPRT protein, or hypoxanthine-guanine phosphoribosyltransferase, is a key enzyme that plays a central role in the generation of purine nucleotides through the purine salvage pathway. HGPRT catalyzes the conversion of guanine to guanosine monophosphate (GMP) and hypoxanthine to inosine monophosphate (IMP). This enzymatic activity involves the transfer of the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine substrates. By facilitating these reactions, HGPRT ensures the efficient utilization of salvaged purines in the synthesis of essential nucleotides, contributing to cellular processes such as DNA and RNA synthesis. The purine salvage pathway, with HGPRT at its core, is crucial for maintaining purine nucleotide pools and overall nucleotide homeostasis in the cell (
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P00492 (M1-A218)
-
Molecular Construction
-
N-term
-
6*His
-
HGPRT (M1-A218)
Accession # P00492 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
HPRT1; HGPRTase; Prev. HPRT; Hypoxanthine Phosphoribosyltransferase; HGPRT; Testicular Tissue Protein Li 89; Hypoxanthine-Guanine Phosphoribosyltransferase; Lesch-Nyhan Syndrome; Hypoxanthine Guanine Phosphoribosyl Transferase; Hypoxanthine Phosphoribosyl
-
AA Sequence
MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
-
Predicted Molecular Mass
27.8 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
