HIST1H2BM Protein, Mouse (His)

The HIST1H2BM protein is a key part of the nucleosome, which compacts DNA into chromatin. HIST1H2BM Protein, Mouse (His) is the recombinant mouse-derived HIST1H2BM protein, expressed by E. coli , with N-6*His labeled tag. The total length of HIST1H2BM Protein, Mouse (His) is 125 a.a., with molecular weight of ~17.8 kDa.

HIST1H2BM protein functions as a core component of the nucleosome, a crucial architectural unit that envelops and compacts DNA into chromatin, thereby limiting DNA accessibility to cellular machineries dependent on DNA templates. Playing a pivotal role in transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability, histones contribute significantly to cellular processes. The regulation of DNA accessibility involves a sophisticated system of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome structure consists of a histone octamer, including two molecules each of H2A, H2B, H3, and H4, assembled into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, reflecting its central role in chromatin organization and genomic function.

Mouse

E. coli

N-6*His

P10854 (P2-K126)

319186  [NCBI]

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Approximately 17.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.