HIST1H2BM Protein, Mouse (His)
The HIST1H2BM protein is a key part of the nucleosome, which compacts DNA into chromatin. HIST1H2BM Protein, Mouse (His) is the recombinant mouse-derived HIST1H2BM protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The HIST1H2BM protein is a key part of the nucleosome, which compacts DNA into chromatin. HIST1H2BM Protein, Mouse (His) is the recombinant mouse-derived HIST1H2BM protein, expressed by E. coli , with N-6*His labeled tag.
HIST1H2BM protein functions as a core component of the nucleosome, a crucial architectural unit that envelops and compacts DNA into chromatin, thereby limiting DNA accessibility to cellular machineries dependent on DNA templates. Playing a pivotal role in transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability, histones contribute significantly to cellular processes. The regulation of DNA accessibility involves a sophisticated system of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome structure consists of a histone octamer, including two molecules each of H2A, H2B, H3, and H4, assembled into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, reflecting its central role in chromatin organization and genomic function.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P10854 (P2-K126)
-
Gene ID319186 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
HIST1H2BM (P2-K126)
Accession # P10854 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
H2BC14; Histone Cluster 1 H2B Family Member M; Prev. HIST1H2BM; Histone Cluster 1, H2bm; Prev. H2BFE; Histone H2B Type 1-M; H2B/E; Histone 1, H2bm; DJ160A22.3; Histone H2B.E; H2B Clustered Histone 14; H2B Histone Family, Member E
-
AA Sequence
PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
-
Predicted Molecular Mass
17.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
