Histo-blood group ABO/ABO Protein, Human (HEK293, Fc)

The Histo-blood group ABO/ABO Protein is an enzyme encoded by the human ABO gene with glycosyltransferase activity. ABO Protein is associated with a variety of infectious and non-communicable diseases. ABO blood group can be used as a tumor marker. Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) is the recombinant human-derived Histo-blood group ABO/ABO protein, expressed by HEK293 , with N-hFc labeled tag.

Tissue blood group ABO system transferase is an enzyme encoded by human ABO gene with glycosyltransferase activity. It is commonly expressed in many tissues and cell types. ABO determines an individual's ABO blood type by modifying oligosaccharides on cell surface glycoproteins. Differences in protein sequences between individuals determine the type of modification and blood type. The ABO gene also contains one of 27 SNPs associated with an increased risk of coronary artery disease. Genetically determined ABO blood groups in humans are associated with an increased risk of various infectious and non-communicable diseases. ABO blood group can be used as tumor marker^[1][2][3].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

N-hFc

ADX99264 (R63-P354)

28  [NCBI]

Partial

RVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

Approximately 62-68 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.