Histone H1 Protein, Human (His)

Histone H1 proteins, particularly the H1.0 variant, are crucial for condensing nucleosome chains, organizing and compacting chromatin. H1.0 is prevalent in cells undergoing terminal differentiation or with low cell division rates. Histone H1 Protein, Human (His) is the recombinant human-derived Histone H1 protein, expressed by E. coli , with N-His labeled tag.

Histone H1 proteins play a vital role in condensing nucleosome chains into higher-order structures, contributing to the organization and compaction of chromatin. Notably, the histone H1.0 variant is predominantly present in cells undergoing terminal stages of differentiation or exhibiting low rates of cell division.

Human

E. coli

N-His

P07305-1 (M1-K194)

3005  [NCBI]

Full Length of Isoform-1

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Approximately 27 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution

1.Supplied as a 0.22 μm filtered solution of 50 mM Tris, 600 mM NaCl, 1 mM DTT, pH 8.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Supplied as a 0.22 μm filtered solution of 50 mM Tris, 600 mM NaCl, 1 mM DTT, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.