Copy Link Print Information

Histone H2A Protein, Xenopus laevis

Customer Review

Based on 1 Customer Validation

Histone H2A, an integral nucleosome component, forms the histone octamer with H2B, H3, and H4. This molecular spool, consisting of two H2A-H2B heterodimers and one H3-H4 heterotetramer, wraps around approximately 147 base pairs of DNA, organizing chromatin structure. The intricate histone-DNA association, especially with H2A, plays a vital role in regulating cellular processes like gene expression and DNA packaging. Histone H2A Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Xenopus laevis
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Histone H2A Protein, Xenopus laevis Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Histone H2A, an integral nucleosome component, forms the histone octamer with H2B, H3, and H4. This molecular spool, consisting of two H2A-H2B heterodimers and one H3-H4 heterotetramer, wraps around approximately 147 base pairs of DNA, organizing chromatin structure. The intricate histone-DNA association, especially with H2A, plays a vital role in regulating cellular processes like gene expression and DNA packaging. Histone H2A Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2A protein, expressed by E. coli , with tag free.

Background

Histone H2A is a crucial component of the nucleosome, a fundamental structural unit in chromatin organization. The nucleosome comprises a histone octamer composed of two copies each of H2A, H2B, H3, and H4, with one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octameric assembly serves as a molecular spool around which approximately 147 base pairs of DNA are intricately wound, contributing to the compact and organized structure of chromatin. The intricate association of histones, including H2A, with DNA in the nucleosome is essential for the regulation of various cellular processes, including gene expression and DNA packaging.

Technical Parameters

  • Species Xenopus laevis
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q6AZJ8 (S1-K129)

  • Gene ID
    494591  [NCBI]
  • Molecular Construction
    • N-term
    • Histone H2A (T17-L197)
      Accession # Q6AZJ8
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Histone H2A; LOC494591; h2ac14.L; hist1h2aj; hist1h2aj.L

  • AA Sequence

    MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKS

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of ddH2O, pH 7.0，5 mM BME, 0.1 mM PMSF.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Histone H2A Protein, Xenopus laevis Product Image
    1/16
  • Histone H2A Protein, Xenopus laevis Product Image