1. Recombinant Proteins
  2. Others
  3. Histone H2B 1.1 Protein, Xenopus laevis

Histone H2B 1.1 Protein, Xenopus laevis

Cat. No.: HY-P72331
Handling Instructions

Histone H2B 1.1 protein is a key nucleosome component that compacts DNA into chromatin, thereby restricting access to cellular processes. Histone H2B 1.1 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2B 1.1 protein, expressed by E. coli , with tag free. The total length of Histone H2B 1.1 Protein, Xenopus laevis is 122 a.a., with molecular weight of ~13.5 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Histone H2B 1.1 protein is a key nucleosome component that compacts DNA into chromatin, thereby restricting access to cellular processes. Histone H2B 1.1 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2B 1.1 protein, expressed by E. coli , with tag free. The total length of Histone H2B 1.1 Protein, Xenopus laevis is 122 a.a., with molecular weight of ~13.5 kDa.

Background

Histone H2B 1.1 is an essential core component of the nucleosome, a fundamental structure that orchestrates the wrapping and compaction of DNA into chromatin, restricting DNA accessibility to cellular machineries reliant on DNA as a template. Histones, including H2B 1.1, assume a central role in pivotal cellular processes such as transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a sophisticated network of post-translational modifications collectively known as the histone code, as well as dynamic nucleosome remodeling. The nucleosome, a histone octamer, consists of two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, highlighting its crucial role in organizing chromatin structure and facilitating key genomic functions.

Species

Xenopus laevis

Source

E. coli

Tag

Tag Free

Accession

P02281 (A2-K123)

Gene ID

446588  [NCBI]

Molecular Construction
N-term
Histone H2B 1.1 (A2-K123)
Accession # P02281
C-term
Synonyms
H2B1.1
AA Sequence

AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Molecular Weight

Approximately 13.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Histone H2B 1.1 Protein, Xenopus laevis Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Histone H2B 1.1 Protein, Xenopus laevis
Cat. No.:
HY-P72331
Quantity:
MCE Japan Authorized Agent: