Histone H2B 1.1 Protein, Xenopus laevis
Based on 1 Customer Validation
Histone H2B 1.1 protein is a key nucleosome component that compacts DNA into chromatin, thereby restricting access to cellular processes. Histone H2B 1.1 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2B 1.1 protein, expressed by E. coli , with tag free.
- Species: Xenopus laevis
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Histone H2B 1.1 protein is a key nucleosome component that compacts DNA into chromatin, thereby restricting access to cellular processes. Histone H2B 1.1 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2B 1.1 protein, expressed by E. coli , with tag free.
Background
Histone H2B 1.1 is an essential core component of the nucleosome, a fundamental structure that orchestrates the wrapping and compaction of DNA into chromatin, restricting DNA accessibility to cellular machineries reliant on DNA as a template. Histones, including H2B 1.1, assume a central role in pivotal cellular processes such as transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a sophisticated network of post-translational modifications collectively known as the histone code, as well as dynamic nucleosome remodeling. The nucleosome, a histone octamer, consists of two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, highlighting its crucial role in organizing chromatin structure and facilitating key genomic functions.
Technical Parameters
-
Species Xenopus laevis
-
Source E. coli
-
Tag Tag Free
-
Accession
P02281 (A5-K126)
-
Gene ID446588 [NCBI]
-
Molecular Construction
-
N-term
-
Histone H2B 1.1 (A2-K123)
Accession # P02281 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
H2B1.1; Histone H2B 1.1
-
AA Sequence
AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of ddH2O, pH 7.0, 5mM BME, 0.1mM PMSF.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (259 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
