Copy Link Print Information

HRAS Protein, Human (sf9, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

HRAS Protein, a key player in initiating Ras protein signal transduction, facilitates the activation of Ras signaling cascades at the molecular level. Under HRAS influence, Ras proteins exhibit GDP/GTP binding and intrinsic GTPase activity, as confirmed by studies. These interactions underscore HRAS's integral role in orchestrating signal transduction dynamics, emphasizing its significance in cellular communication and regulation. HRAS Protein, Human (sf9, His) is the recombinant human-derived HRAS protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • HRAS Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HRAS Protein, a key player in initiating Ras protein signal transduction, facilitates the activation of Ras signaling cascades at the molecular level. Under HRAS influence, Ras proteins exhibit GDP/GTP binding and intrinsic GTPase activity, as confirmed by studies. These interactions underscore HRAS's integral role in orchestrating signal transduction dynamics, emphasizing its significance in cellular communication and regulation. HRAS Protein, Human (sf9, His) is the recombinant human-derived HRAS protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

HRAS protein emerges as a key player in the initiation of Ras protein signal transduction, a pivotal process in cellular signaling. Operating at the molecular level, HRAS facilitates the activation of Ras signaling cascades. Ras proteins, under the influence of HRAS, demonstrate a capability to bind GDP/GTP and exhibit intrinsic GTPase activity, as substantiated by various studies. These molecular interactions underscore the integral role of HRAS in orchestrating the dynamics of signal transduction pathways, shedding light on its significance in cellular communication and regulation.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    P01112-1 (M1-C186)

  • Gene ID
    3265  [NCBI]
  • Molecular Construction
    • N-term
    • HRAS (M1-C186)
      Accession # P01112-1
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    HRAS; C-Has/Bas P21 Protein; Prev. HRAS1; P21 Protein; V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog; C-HA-RAS1; Harvey Rat Sarcoma Viral Oncogene Homolog; C-BAS/HAS; Transforming Protein P21; H-RASIDX; GTPase HRas; C-H-RAS; P21ras; H-Ras-1; Ras Fami

  • AA Sequence

    MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

  • Predicted Molecular Mass

    22.5 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HRAS Protein, Human (sf9, His) Product Image
    1/16
  • HRAS Protein, Human (sf9, His) Product Image