HSPB2 Protein, Human (His)
HSPB2 Protein potentially regulates the kinase DMPK, enhancing its activity and influencing cellular processes. The specific mechanisms and broader implications in cellular signaling pathways require elucidation. Comprehensive studies are essential to unravel the precise molecular pathways and functional significance of the HSPB2-DMPK interplay, shedding light on its potential contributions to cellular regulation and signaling cascades. HSPB2 Protein, Human (His) is the recombinant human-derived HSPB2 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HSPB2 Protein potentially regulates the kinase DMPK, enhancing its activity and influencing cellular processes. The specific mechanisms and broader implications in cellular signaling pathways require elucidation. Comprehensive studies are essential to unravel the precise molecular pathways and functional significance of the HSPB2-DMPK interplay, shedding light on its potential contributions to cellular regulation and signaling cascades. HSPB2 Protein, Human (His) is the recombinant human-derived HSPB2 protein, expressed by E. coli , with C-6*His labeled tag.
Background
HSPB2 Protein emerges as a potential regulator, indicating its role in modulating the kinase DMPK. This interaction with DMPK suggests that HSPB2 may play a role in enhancing the kinase activity of DMPK, underscoring its potential influence on cellular processes governed by this kinase. The specific mechanisms through which HSPB2 regulates DMPK and the broader implications of this interaction in cellular signaling pathways remain to be fully elucidated. Comprehensive studies are essential to unravel the precise molecular pathways and functional significance of the HSPB2-DMPK interplay, shedding light on its potential contributions to cellular regulation and signaling cascades.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q16082 (M1-P182)
-
Molecular Construction
-
N-term
-
HSPB2 (M1-P182)
Accession # Q16082 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
HSPB2; DMPK-Binding Protein; Heat Shock Protein Family B (Small) Member 2; Heat Shock 27kD Protein 2; MKBP; Heat-Shock Protein Beta-2; Hs.78846; LOH11CR1K; Heat Shock Protein Family B Member 2; HSP27; Heat Shock 27kDa Protein 2; HspB2; Heat Shock Protein
-
AA Sequence
MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
-
Predicted Molecular Mass
21.3 kDa
-
Molecular Weight
Approximately 22-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
