HSPB8 Protein, Human (His)

The HSPB8 protein exhibits temperature-dependent chaperone activity and functions as a monomer in its molecular form. It interacts with other cellular proteins to form complexes critical for cellular homeostasis. HSPB8 Protein, Human (His) is the recombinant human-derived HSPB8 protein, expressed by E. coli , with C-6*His labeled tag. The total length of HSPB8 Protein, Human (His) is 196 a.a., with molecular weight of ~23.0 kDa.

HSPB8 (Heat Shock Protein Family B [Small] Member 8) exhibits temperature-dependent chaperone activity, functioning as a monomer. It interacts with HSPB1, suggesting potential collaborative roles in cellular protein folding and quality control mechanisms. Additionally, HSPB8 interacts with DNAJB6, indicating its involvement in the broader network of chaperone proteins. The interaction with BAG3 further emphasizes its role in protein homeostasis, as BAG3 is associated with the regulation of protein degradation processes. These interactions collectively highlight the versatility of HSPB8 in cellular stress responses and protein quality control, positioning it as a key player in maintaining proteostasis.

Human

E. coli

C-6*His

Q9UJY1 (M1-T196)

26353  [NCBI]

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

Approximately 23.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.