HSPB8 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The HSPB8 protein exhibits temperature-dependent chaperone activity and functions as a monomer in its molecular form.It interacts with other cellular proteins to form complexes critical for cellular homeostasis.HSPB8 Protein, Human (His) is the recombinant human-derived HSPB8 protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The HSPB8 protein exhibits temperature-dependent chaperone activity and functions as a monomer in its molecular form.It interacts with other cellular proteins to form complexes critical for cellular homeostasis.HSPB8 Protein, Human (His) is the recombinant human-derived HSPB8 protein, expressed by E.coli , with C-6*His labeled tag.

Background

HSPB8 (Heat Shock Protein Family B [Small] Member 8) exhibits temperature-dependent chaperone activity, functioning as a monomer. It interacts with HSPB1, suggesting potential collaborative roles in cellular protein folding and quality control mechanisms. Additionally, HSPB8 interacts with DNAJB6, indicating its involvement in the broader network of chaperone proteins. The interaction with BAG3 further emphasizes its role in protein homeostasis, as BAG3 is associated with the regulation of protein degradation processes. These interactions collectively highlight the versatility of HSPB8 in cellular stress responses and protein quality control, positioning it as a key player in maintaining proteostasis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • HSPB8 (M1-T196)
      Accession # Q9UJY1
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    HSPB8; Alpha-Crystallin C Chain; Heat Shock Protein Family B (Small) Member 8; Protein Kinase H11; E2IG1; HSPB8-N1; HSP22; HSPB8-N2; CMT2L; DHMN2; H11; HMN2A; Small Stress Protein-Like Protein HSP22; HMND2; Heat Shock Protein Family B Member 8; MFM13; Hea

  • AA Sequence

    MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

  • Predicted Molecular Mass

    22.7 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00