IBSP Protein, Human (His-SUMO)
Based on 1 Customer Validation
The IBSP protein has a strong affinity for hydroxyapatite and plays a crucial role in mineralized matrix formation, indicating its overall nature in this regard. Its tight binding suggests an important role in cell-matrix interactions, particularly in promoting RGD-dependent cell attachment. IBSP Protein, Human (His-SUMO) is the recombinant human-derived IBSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IBSP protein has a strong affinity for hydroxyapatite and plays a crucial role in mineralized matrix formation, indicating its overall nature in this regard. Its tight binding suggests an important role in cell-matrix interactions, particularly in promoting RGD-dependent cell attachment. IBSP Protein, Human (His-SUMO) is the recombinant human-derived IBSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
IBSP protein exhibits strong binding affinity to hydroxyapatite, suggesting a crucial role in the formation of the mineralized matrix. It is likely to be an integral component of this matrix, implying its significance in cell-matrix interactions. Notably, IBSP protein plays a key role in promoting Arg-Gly-Asp (RGD)-dependent cell attachment, emphasizing its involvement in cellular adhesion processes. The observed tight binding to hydroxyapatite and its apparent integration into the mineralized matrix underscore the importance of IBSP in contributing to the structural and functional aspects of cell-matrix interactions within biological systems.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P21815 (A129-E281)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
IBSP (A129-E281)
Accession # P21815 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IBSP; Integrin-Binding Sialoprotein; Integrin Binding Sialoprotein; Cell-Binding Sialoprotein; Bone Sialoprotein II; Bone Sialoprotein 2; BSP-II; BSP II; SP-II; BNSP; BSP; Bone Sialoprotein
-
AA Sequence
AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE
-
Predicted Molecular Mass
32.4 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1. Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2. Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
