ICOS Protein, Rhesus macaque (HEK293,Fc)

ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293,Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ICOS Protein, Rhesus macaque (HEK293,Fc) is 121 a.a., with molecular weight of 50-60 kDa.

The ICOS protein plays a crucial role in enhancing all fundamental T-cell responses to foreign antigens, including promoting cell proliferation, secretion of lymphokines, up-regulation of molecules involved in cell-cell interaction, and facilitating effective help for antibody secretion by B-cells. It is indispensable for facilitating efficient communication between T and B-cells, as well as for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it has the ability to superinduce the synthesis of interleukin-10. Additionally, ICOS prevents the apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. It exists as a homodimer connected by disulfide bonds.

Rhesus Macaque

HEK293

C-hFc

H9Z062 (G20-K140)

705788  [NCBI]

GEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

50-60 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.